FuNGI

A0A2I2FMN3

Protein Details

Accession

A0A2I2FMN3

Localization Confidence

Low

Confidence Score

9.9

NoLS Segment(s)

Position	Sequence	Protein Nature
5-38	RDSRHKRSATGAKRSQYRKKRAFEKGRQTANTRI	Hydrophilic

NLS Segment(s)

Position	Sequence
8-56	RHKRSATGAKRSQYRKKRAFEKGRQTANTRIGSKRIHLVRTRGGNRKFR

Subcellular Location(s)

mito 15, cyto 7, nucl 5

Family & Domain DBs

InterPro	View protein in InterPro IPR004843 Calcineurin-like_PHP_ApaH IPR029052 Metallo-depent_PP-like IPR001047 Ribosomal_S8e IPR022309 Ribosomal_S8e/biogenesis_NSA2
Gene Ontology	GO:1990904 C:ribonucleoprotein complex GO:0005840 C:ribosome GO:0016787 F:hydrolase activity GO:0003735 F:structural constituent of ribosome GO:0042254 P:ribosome biogenesis GO:0006412 P:translation
Pfam	View protein in Pfam PF00149 Metallophos PF01201 Ribosomal_S8e
CDD	cd07379 MPP_239FB cd11380 Ribosomal_S8e_like

Amino Acid Sequences

MGISRDSRHKRSATGAKRSQYRKKRAFEKGRQTANTRIGSKRIHLVRTRGGNRKFRALRLESGNFSWGSEGISRKTRVIVVAYHPSNNELVRTNTLTKSAVVQIDAAPFRQWYEAHYGQPIGRRRQQKSEVPEEKKSNSVQKKQAARFAESGKVESAIERQFESGRVYAVIASRPGQSGRVDGYILEGDELAFYQKAIRKTKMPSTKTRLCLLSDTHTTLPASPAHTTNPYRHPLPQADVLIHAGDLTKVGRLEEHTRMVDLLASAPAELKLVIPGNHDITLDEEYYHRIGHYRHRYRSGHKGSLPQEGPIEDPAVVKALYTDESARAAGIVYLEEGTHRLRVPSTGATFTVYASPWTPEFCEWAFAYKRGAVDRFNPPSPRRKLSEAQPGAKRAFSAPHPAPDFPDVDIVITHGPPYGVLDRVVPGGFSVGCEDLFKAVERARPLLHVFGHIHEGYGAVRYEWSSRNESMVQCDGEKTVKERGAYIDGSAGSGTPLRVGDETLFINASVCTVDYEAVNAPWVVDLDLPIQVGG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.68
2	0.7
3	0.7
4	0.77
5	0.82
6	0.83
7	0.83
8	0.84
9	0.83
10	0.84
11	0.87
12	0.89
13	0.9
14	0.91
15	0.91
16	0.9
17	0.9
18	0.85
19	0.8
20	0.78
21	0.75
22	0.72
23	0.65
24	0.59
25	0.56
26	0.54
27	0.52
28	0.52
29	0.5
30	0.51
31	0.52
32	0.55
33	0.57
34	0.64
35	0.69
36	0.7
37	0.72
38	0.74
39	0.71
40	0.75
41	0.72
42	0.66
43	0.67
44	0.62
45	0.61
46	0.6
47	0.61
48	0.53
49	0.5
50	0.48
51	0.38
52	0.34
53	0.27
54	0.19
55	0.16
56	0.17
57	0.18
58	0.19
59	0.26
60	0.28
61	0.28
62	0.3
63	0.3
64	0.28
65	0.28
66	0.28
67	0.27
68	0.35
69	0.36
70	0.36
71	0.34
72	0.33
73	0.33
74	0.29
75	0.25
76	0.19
77	0.2
78	0.22
79	0.26
80	0.28
81	0.27
82	0.29
83	0.28
84	0.25
85	0.25
86	0.25
87	0.22
88	0.19
89	0.19
90	0.18
91	0.22
92	0.22
93	0.2
94	0.16
95	0.15
96	0.16
97	0.17
98	0.16
99	0.13
100	0.21
101	0.24
102	0.25
103	0.27
104	0.27
105	0.27
106	0.34
107	0.39
108	0.38
109	0.42
110	0.49
111	0.52
112	0.6
113	0.66
114	0.67
115	0.68
116	0.71
117	0.74
118	0.71
119	0.74
120	0.69
121	0.63
122	0.6
123	0.56
124	0.55
125	0.54
126	0.56
127	0.56
128	0.59
129	0.67
130	0.67
131	0.69
132	0.63
133	0.58
134	0.54
135	0.49
136	0.47
137	0.38
138	0.36
139	0.29
140	0.26
141	0.22
142	0.18
143	0.19
144	0.15
145	0.16
146	0.15
147	0.15
148	0.15
149	0.16
150	0.18
151	0.15
152	0.13
153	0.12
154	0.12
155	0.12
156	0.13
157	0.13
158	0.11
159	0.12
160	0.12
161	0.13
162	0.13
163	0.14
164	0.13
165	0.14
166	0.15
167	0.14
168	0.13
169	0.12
170	0.13
171	0.12
172	0.11
173	0.09
174	0.07
175	0.06
176	0.06
177	0.06
178	0.05
179	0.04
180	0.04
181	0.08
182	0.12
183	0.19
184	0.24
185	0.26
186	0.3
187	0.35
188	0.45
189	0.51
190	0.52
191	0.55
192	0.59
193	0.64
194	0.63
195	0.63
196	0.55
197	0.47
198	0.44
199	0.37
200	0.33
201	0.28
202	0.27
203	0.24
204	0.23
205	0.21
206	0.19
207	0.18
208	0.15
209	0.15
210	0.13
211	0.13
212	0.14
213	0.19
214	0.21
215	0.24
216	0.28
217	0.3
218	0.3
219	0.31
220	0.34
221	0.31
222	0.32
223	0.32
224	0.26
225	0.24
226	0.23
227	0.21
228	0.16
229	0.14
230	0.1
231	0.06
232	0.05
233	0.05
234	0.05
235	0.05
236	0.05
237	0.05
238	0.06
239	0.08
240	0.13
241	0.15
242	0.18
243	0.17
244	0.17
245	0.17
246	0.17
247	0.15
248	0.1
249	0.08
250	0.05
251	0.05
252	0.05
253	0.05
254	0.05
255	0.04
256	0.04
257	0.04
258	0.05
259	0.06
260	0.07
261	0.08
262	0.1
263	0.11
264	0.11
265	0.11
266	0.1
267	0.11
268	0.12
269	0.1
270	0.09
271	0.08
272	0.09
273	0.1
274	0.1
275	0.08
276	0.09
277	0.1
278	0.19
279	0.3
280	0.37
281	0.41
282	0.49
283	0.53
284	0.55
285	0.65
286	0.63
287	0.59
288	0.53
289	0.57
290	0.51
291	0.56
292	0.51
293	0.41
294	0.34
295	0.28
296	0.26
297	0.19
298	0.18
299	0.1
300	0.09
301	0.08
302	0.08
303	0.08
304	0.07
305	0.06
306	0.06
307	0.07
308	0.08
309	0.08
310	0.08
311	0.09
312	0.09
313	0.08
314	0.08
315	0.07
316	0.06
317	0.05
318	0.05
319	0.04
320	0.04
321	0.04
322	0.05
323	0.06
324	0.07
325	0.08
326	0.09
327	0.09
328	0.09
329	0.1
330	0.13
331	0.16
332	0.17
333	0.17
334	0.17
335	0.18
336	0.18
337	0.17
338	0.16
339	0.12
340	0.11
341	0.1
342	0.11
343	0.1
344	0.11
345	0.12
346	0.11
347	0.14
348	0.13
349	0.15
350	0.14
351	0.2
352	0.2
353	0.2
354	0.22
355	0.2
356	0.22
357	0.22
358	0.24
359	0.2
360	0.24
361	0.32
362	0.36
363	0.38
364	0.43
365	0.44
366	0.52
367	0.56
368	0.57
369	0.52
370	0.53
371	0.54
372	0.56
373	0.63
374	0.61
375	0.61
376	0.61
377	0.61
378	0.56
379	0.5
380	0.43
381	0.33
382	0.29
383	0.24
384	0.28
385	0.26
386	0.32
387	0.35
388	0.34
389	0.36
390	0.34
391	0.33
392	0.25
393	0.25
394	0.18
395	0.15
396	0.14
397	0.13
398	0.12
399	0.1
400	0.1
401	0.08
402	0.07
403	0.07
404	0.11
405	0.11
406	0.11
407	0.12
408	0.13
409	0.13
410	0.15
411	0.15
412	0.11
413	0.09
414	0.1
415	0.09
416	0.09
417	0.1
418	0.09
419	0.09
420	0.1
421	0.1
422	0.1
423	0.11
424	0.11
425	0.12
426	0.14
427	0.18
428	0.2
429	0.22
430	0.22
431	0.25
432	0.26
433	0.27
434	0.25
435	0.27
436	0.26
437	0.24
438	0.29
439	0.25
440	0.23
441	0.19
442	0.19
443	0.14
444	0.15
445	0.14
446	0.09
447	0.1
448	0.1
449	0.15
450	0.19
451	0.23
452	0.25
453	0.26
454	0.3
455	0.34
456	0.34
457	0.36
458	0.36
459	0.33
460	0.28
461	0.29
462	0.26
463	0.25
464	0.26
465	0.23
466	0.27
467	0.28
468	0.28
469	0.29
470	0.31
471	0.33
472	0.32
473	0.29
474	0.25
475	0.22
476	0.22
477	0.2
478	0.15
479	0.11
480	0.12
481	0.11
482	0.09
483	0.1
484	0.11
485	0.11
486	0.13
487	0.13
488	0.15
489	0.16
490	0.16
491	0.16
492	0.13
493	0.14
494	0.12
495	0.11
496	0.09
497	0.08
498	0.08
499	0.08
500	0.09
501	0.09
502	0.11
503	0.12
504	0.12
505	0.13
506	0.12
507	0.11
508	0.11
509	0.12
510	0.1
511	0.09
512	0.1
513	0.1
514	0.12

A0A2I2FMN3

3D AlphaFold-predicted Structure Viewer