Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FH48

Protein Details
Accession A0A2I2FH48   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-124KHEATAKTDKQKKKQIHFPQRKYAVKAHydrophilic
NLS Segment(s)
PositionSequence
85-115RPKLTRALRRRLTKHEATAKTDKQKKKQIHF
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSKVKAGQLWGKSKDDLTKQLEELKFDLNQLRVQKIAGGASAKTQRIHDVRKSIARVLTVINANQRSQLRLFYKNKKFLPLDLRPKLTRALRRRLTKHEATAKTDKQKKKQIHFPQRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.45
4 0.45
5 0.43
6 0.42
7 0.4
8 0.47
9 0.46
10 0.41
11 0.37
12 0.32
13 0.27
14 0.25
15 0.27
16 0.21
17 0.24
18 0.24
19 0.24
20 0.21
21 0.21
22 0.2
23 0.18
24 0.16
25 0.13
26 0.12
27 0.1
28 0.15
29 0.19
30 0.19
31 0.19
32 0.19
33 0.23
34 0.27
35 0.32
36 0.32
37 0.33
38 0.35
39 0.38
40 0.4
41 0.36
42 0.33
43 0.28
44 0.24
45 0.2
46 0.19
47 0.15
48 0.14
49 0.16
50 0.16
51 0.15
52 0.19
53 0.18
54 0.17
55 0.17
56 0.22
57 0.22
58 0.3
59 0.37
60 0.43
61 0.51
62 0.58
63 0.58
64 0.59
65 0.57
66 0.53
67 0.55
68 0.55
69 0.57
70 0.54
71 0.58
72 0.52
73 0.52
74 0.53
75 0.5
76 0.51
77 0.48
78 0.53
79 0.57
80 0.65
81 0.7
82 0.73
83 0.74
84 0.71
85 0.72
86 0.71
87 0.67
88 0.65
89 0.68
90 0.67
91 0.69
92 0.72
93 0.72
94 0.71
95 0.76
96 0.78
97 0.79
98 0.83
99 0.84
100 0.86
101 0.89
102 0.88
103 0.89
104 0.9