Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FEC5

Protein Details
Accession A0A2I2FEC5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-45VKSATPKVDKQEKKKQPKGRAMKRLKYTRRFVHydrophilic
NLS Segment(s)
PositionSequence
11-41AGKVKSATPKVDKQEKKKQPKGRAMKRLKYT
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSATPKVDKQEKKKQPKGRAMKRLKYTRRFVNVTMTGGKRKMNPNPGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.38
4 0.39
5 0.42
6 0.49
7 0.53
8 0.61
9 0.64
10 0.65
11 0.69
12 0.73
13 0.78
14 0.81
15 0.82
16 0.81
17 0.84
18 0.86
19 0.85
20 0.86
21 0.84
22 0.83
23 0.83
24 0.84
25 0.83
26 0.81
27 0.77
28 0.75
29 0.74
30 0.69
31 0.61
32 0.6
33 0.54
34 0.49
35 0.48
36 0.42
37 0.39
38 0.38
39 0.39
40 0.36
41 0.41
42 0.47
43 0.5