Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2F483

Protein Details
Accession A0A2I2F483    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
38-60MLSKKLLRARRLRRLDPTRETKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto 9, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000308  14-3-3  
IPR036815  14-3-3_dom_sf  
IPR023410  14-3-3_domain  
Pfam View protein in Pfam  
PF00244  14-3-3  
Amino Acid Sequences MASSEVDQKALANVAAATTFESPLLSAMLYKILGLSIMLSKKLLRARRLRRLDPTRETKSLQLYHHVIWLSREGLVILEQFVFPMVHVSVELQILAYKLRASFYHIFVLFHNQPAIHSPGILSLAGNPASRSESPSKDSMSRFSFQGRGEELTVPERHSSSRNSSRAKVAKAPPGLAPVRPSHTAAFLLPALDYTPTATACFDQAVLLADQFLPGSHPLRLSIKLEYAAYLYDCLHDSHACRRLAKQAISDVYNAQEGMDDESFTDAAEIVRVLGKMVKRGRKTSTLEGGSTTTPSMTPGGENSRSDGSRSQAETPPPRRASQPKAKVAASRLPIPVKMGQKAWPPAVPDPTIMNPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.09
4 0.1
5 0.1
6 0.1
7 0.09
8 0.1
9 0.09
10 0.1
11 0.1
12 0.08
13 0.07
14 0.07
15 0.09
16 0.09
17 0.09
18 0.08
19 0.07
20 0.07
21 0.07
22 0.08
23 0.11
24 0.13
25 0.13
26 0.14
27 0.15
28 0.2
29 0.27
30 0.33
31 0.37
32 0.46
33 0.56
34 0.66
35 0.74
36 0.76
37 0.8
38 0.82
39 0.83
40 0.82
41 0.81
42 0.78
43 0.73
44 0.69
45 0.62
46 0.61
47 0.57
48 0.49
49 0.47
50 0.43
51 0.4
52 0.42
53 0.38
54 0.3
55 0.26
56 0.27
57 0.2
58 0.17
59 0.16
60 0.12
61 0.12
62 0.12
63 0.1
64 0.08
65 0.08
66 0.07
67 0.07
68 0.08
69 0.08
70 0.06
71 0.08
72 0.07
73 0.07
74 0.07
75 0.08
76 0.08
77 0.08
78 0.08
79 0.06
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.09
87 0.09
88 0.15
89 0.19
90 0.21
91 0.27
92 0.26
93 0.27
94 0.26
95 0.34
96 0.28
97 0.25
98 0.24
99 0.17
100 0.17
101 0.19
102 0.22
103 0.14
104 0.13
105 0.12
106 0.12
107 0.13
108 0.13
109 0.09
110 0.07
111 0.09
112 0.11
113 0.11
114 0.1
115 0.1
116 0.13
117 0.13
118 0.17
119 0.19
120 0.21
121 0.24
122 0.26
123 0.28
124 0.29
125 0.3
126 0.31
127 0.3
128 0.29
129 0.27
130 0.27
131 0.29
132 0.24
133 0.27
134 0.23
135 0.2
136 0.2
137 0.2
138 0.19
139 0.19
140 0.19
141 0.17
142 0.16
143 0.15
144 0.15
145 0.16
146 0.18
147 0.23
148 0.31
149 0.37
150 0.4
151 0.41
152 0.48
153 0.5
154 0.49
155 0.48
156 0.44
157 0.44
158 0.42
159 0.41
160 0.34
161 0.34
162 0.32
163 0.25
164 0.23
165 0.18
166 0.2
167 0.2
168 0.21
169 0.16
170 0.16
171 0.16
172 0.14
173 0.14
174 0.1
175 0.09
176 0.08
177 0.07
178 0.06
179 0.06
180 0.06
181 0.05
182 0.05
183 0.05
184 0.06
185 0.06
186 0.06
187 0.06
188 0.07
189 0.06
190 0.05
191 0.05
192 0.06
193 0.06
194 0.06
195 0.06
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.06
202 0.08
203 0.08
204 0.08
205 0.1
206 0.13
207 0.15
208 0.16
209 0.16
210 0.16
211 0.17
212 0.16
213 0.15
214 0.13
215 0.11
216 0.1
217 0.09
218 0.08
219 0.08
220 0.08
221 0.09
222 0.1
223 0.11
224 0.12
225 0.19
226 0.26
227 0.27
228 0.28
229 0.29
230 0.36
231 0.41
232 0.41
233 0.37
234 0.36
235 0.37
236 0.37
237 0.36
238 0.28
239 0.23
240 0.21
241 0.18
242 0.12
243 0.1
244 0.09
245 0.12
246 0.11
247 0.1
248 0.09
249 0.11
250 0.11
251 0.09
252 0.09
253 0.05
254 0.05
255 0.05
256 0.05
257 0.05
258 0.07
259 0.07
260 0.07
261 0.1
262 0.11
263 0.19
264 0.27
265 0.35
266 0.38
267 0.43
268 0.48
269 0.54
270 0.59
271 0.59
272 0.61
273 0.56
274 0.51
275 0.48
276 0.45
277 0.37
278 0.31
279 0.23
280 0.15
281 0.11
282 0.12
283 0.12
284 0.1
285 0.1
286 0.13
287 0.2
288 0.23
289 0.24
290 0.25
291 0.29
292 0.29
293 0.31
294 0.3
295 0.27
296 0.3
297 0.32
298 0.34
299 0.34
300 0.42
301 0.5
302 0.53
303 0.6
304 0.57
305 0.56
306 0.59
307 0.63
308 0.64
309 0.65
310 0.7
311 0.68
312 0.71
313 0.71
314 0.68
315 0.65
316 0.63
317 0.56
318 0.52
319 0.49
320 0.46
321 0.44
322 0.43
323 0.44
324 0.42
325 0.42
326 0.38
327 0.39
328 0.44
329 0.49
330 0.49
331 0.45
332 0.44
333 0.46
334 0.49
335 0.45
336 0.38
337 0.37