Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FIB9

Protein Details
Accession A0A2I2FIB9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
80-99MIRGAAKKKKENTRQSSASCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, extr 8, cyto_mito 8
Family & Domain DBs
Amino Acid Sequences MSRSRLSPPILGHRSAIIASCHVILSDALRLSSRPFHVCRSGEVDRNHECSSSNRPQQGGGSQRWPWRVLGESGLTPIGMIRGAAKKKKENTRQSSASCLNRGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.26
4 0.16
5 0.14
6 0.13
7 0.13
8 0.12
9 0.1
10 0.11
11 0.09
12 0.09
13 0.11
14 0.1
15 0.1
16 0.1
17 0.1
18 0.12
19 0.16
20 0.18
21 0.19
22 0.21
23 0.24
24 0.31
25 0.31
26 0.32
27 0.35
28 0.35
29 0.37
30 0.37
31 0.38
32 0.35
33 0.38
34 0.36
35 0.29
36 0.27
37 0.23
38 0.29
39 0.32
40 0.33
41 0.31
42 0.31
43 0.31
44 0.31
45 0.34
46 0.31
47 0.26
48 0.26
49 0.28
50 0.32
51 0.33
52 0.33
53 0.28
54 0.25
55 0.25
56 0.21
57 0.2
58 0.18
59 0.16
60 0.16
61 0.16
62 0.13
63 0.11
64 0.09
65 0.07
66 0.05
67 0.05
68 0.07
69 0.15
70 0.21
71 0.27
72 0.34
73 0.41
74 0.51
75 0.61
76 0.69
77 0.73
78 0.75
79 0.79
80 0.8
81 0.75
82 0.75
83 0.72
84 0.68