Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2F0I3

Protein Details
Accession A0A2I2F0I3   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-30GRLDMMRGGRRRRTRRGCFRFHSGGBasic
58-91NKNKTPDKTTNPKPQNPPKKKKNTSPRPSTQPAPHydrophilic
NLS Segment(s)
PositionSequence
13-21GGRRRRTRR
65-84KTTNPKPQNPPKKKKNTSPR
Subcellular Location(s) mito 16.5, mito_nucl 13, nucl 8.5
Family & Domain DBs
Amino Acid Sequences MVLILGRLDMMRGGRRRRTRRGCFRFHSGGRVRIRLRLLLLLLLRRLHLQSKPLPPQNKNKTPDKTTNPKPQNPPKKKKNTSPRPSTQPAPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.52
3 0.6
4 0.69
5 0.77
6 0.81
7 0.85
8 0.87
9 0.87
10 0.82
11 0.82
12 0.8
13 0.7
14 0.69
15 0.63
16 0.62
17 0.56
18 0.57
19 0.5
20 0.46
21 0.45
22 0.37
23 0.33
24 0.26
25 0.22
26 0.18
27 0.18
28 0.15
29 0.14
30 0.13
31 0.12
32 0.11
33 0.12
34 0.12
35 0.12
36 0.15
37 0.2
38 0.28
39 0.35
40 0.41
41 0.46
42 0.49
43 0.58
44 0.64
45 0.67
46 0.64
47 0.66
48 0.67
49 0.67
50 0.71
51 0.69
52 0.69
53 0.69
54 0.75
55 0.75
56 0.76
57 0.79
58 0.81
59 0.84
60 0.85
61 0.87
62 0.87
63 0.9
64 0.91
65 0.91
66 0.92
67 0.92
68 0.91
69 0.91
70 0.89
71 0.87
72 0.85