Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FMN7

Protein Details
Accession A0A2I2FMN7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-82RSCMDEKRPKSNKQNTINYHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12.666, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MPPKGATTTLNPIRLQTINHLRVRRPNRQDLNPCQAIMSSMLSCWASSGYTVEGCGALEQQLRSCMDEKRPKSNKQNTINYHLSRMYPKVVGPKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.33
4 0.37
5 0.4
6 0.46
7 0.48
8 0.47
9 0.55
10 0.62
11 0.63
12 0.6
13 0.63
14 0.65
15 0.71
16 0.77
17 0.75
18 0.75
19 0.67
20 0.59
21 0.49
22 0.41
23 0.32
24 0.24
25 0.18
26 0.1
27 0.07
28 0.09
29 0.09
30 0.08
31 0.08
32 0.07
33 0.05
34 0.05
35 0.06
36 0.05
37 0.05
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.07
46 0.07
47 0.08
48 0.1
49 0.11
50 0.13
51 0.15
52 0.17
53 0.25
54 0.34
55 0.37
56 0.46
57 0.53
58 0.6
59 0.69
60 0.76
61 0.76
62 0.77
63 0.83
64 0.78
65 0.78
66 0.78
67 0.69
68 0.63
69 0.55
70 0.48
71 0.42
72 0.4
73 0.35
74 0.28
75 0.29
76 0.36