Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FNM7

Protein Details
Accession A0A2I2FNM7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
62-84VVRTWQEKEKKKSIKNIKLREVVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, mito 4, extr 3, E.R. 3, plas 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVAIAVCGWKGFMEPLLSLHNTGAPIWHQSHASGHMTPNPNMATYKTGLLPVICSALIQYFVVRTWQEKEKKKSIKNIKLREVVGISRNKAIAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.17
4 0.17
5 0.17
6 0.16
7 0.16
8 0.15
9 0.14
10 0.13
11 0.1
12 0.13
13 0.14
14 0.15
15 0.14
16 0.14
17 0.16
18 0.18
19 0.2
20 0.17
21 0.16
22 0.21
23 0.24
24 0.24
25 0.25
26 0.22
27 0.2
28 0.19
29 0.19
30 0.15
31 0.13
32 0.14
33 0.11
34 0.11
35 0.11
36 0.1
37 0.09
38 0.08
39 0.08
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.06
46 0.06
47 0.05
48 0.06
49 0.08
50 0.08
51 0.1
52 0.14
53 0.22
54 0.31
55 0.4
56 0.47
57 0.55
58 0.65
59 0.69
60 0.76
61 0.79
62 0.8
63 0.82
64 0.84
65 0.82
66 0.8
67 0.74
68 0.68
69 0.61
70 0.54
71 0.51
72 0.48
73 0.41
74 0.38