Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8LU31

Protein Details
Accession B8LU31    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-51DTKRDRYDTKRDRTKPERCDBasic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
Amino Acid Sequences MNVTTPNECYDTKRDRYDTKRDRYDTKRDWYDTKRDRYDTKRDRTKPERCDIKRDCYRHQMNVTAPNGIITDTKREHYRDQMNVTTPNGNVTSTKRERTLTPNENAHLTPNRTLLKPNGSITDTKWEHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.57
3 0.63
4 0.7
5 0.71
6 0.73
7 0.76
8 0.74
9 0.77
10 0.75
11 0.78
12 0.75
13 0.74
14 0.72
15 0.66
16 0.69
17 0.66
18 0.69
19 0.68
20 0.69
21 0.66
22 0.62
23 0.66
24 0.66
25 0.71
26 0.7
27 0.71
28 0.73
29 0.72
30 0.77
31 0.79
32 0.81
33 0.78
34 0.77
35 0.78
36 0.7
37 0.75
38 0.69
39 0.7
40 0.69
41 0.66
42 0.61
43 0.6
44 0.61
45 0.56
46 0.53
47 0.48
48 0.42
49 0.44
50 0.4
51 0.31
52 0.27
53 0.22
54 0.2
55 0.16
56 0.14
57 0.08
58 0.12
59 0.12
60 0.15
61 0.17
62 0.2
63 0.22
64 0.29
65 0.35
66 0.34
67 0.38
68 0.4
69 0.4
70 0.39
71 0.39
72 0.33
73 0.26
74 0.24
75 0.19
76 0.16
77 0.15
78 0.16
79 0.24
80 0.27
81 0.3
82 0.3
83 0.31
84 0.34
85 0.4
86 0.47
87 0.45
88 0.47
89 0.49
90 0.48
91 0.49
92 0.46
93 0.44
94 0.4
95 0.36
96 0.32
97 0.34
98 0.35
99 0.33
100 0.37
101 0.37
102 0.38
103 0.39
104 0.39
105 0.38
106 0.37
107 0.37
108 0.37
109 0.42