Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2F1H5

Protein Details
Accession A0A2I2F1H5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
73-97LDARGKREVRKIMKRRKVNFDEARRBasic
NLS Segment(s)
PositionSequence
76-89RGKREVRKIMKRRK
Subcellular Location(s) extr 9, E.R. 6, cyto 3, mito 2, plas 2, cyto_nucl 2, golg 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018559  DUF2015  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF09435  DUF2015  
Amino Acid Sequences MEYYLFYSLLLTVVICGTALYLTRSRWLPLITVPDYIYDRLPSSFAGDIEAGLTSSHFDLSGNVVDGDSRAGLDARGKREVRKIMKRRKVNFDEARRIYTERTFSKHNIGPDGRPKDPRFVSFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.05
6 0.06
7 0.08
8 0.11
9 0.11
10 0.16
11 0.17
12 0.18
13 0.2
14 0.2
15 0.18
16 0.19
17 0.26
18 0.23
19 0.24
20 0.23
21 0.22
22 0.23
23 0.23
24 0.2
25 0.14
26 0.14
27 0.13
28 0.13
29 0.11
30 0.12
31 0.12
32 0.11
33 0.12
34 0.1
35 0.1
36 0.09
37 0.09
38 0.07
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.04
56 0.04
57 0.03
58 0.04
59 0.04
60 0.09
61 0.13
62 0.16
63 0.23
64 0.24
65 0.26
66 0.33
67 0.42
68 0.46
69 0.53
70 0.61
71 0.65
72 0.74
73 0.81
74 0.82
75 0.84
76 0.81
77 0.81
78 0.8
79 0.78
80 0.79
81 0.72
82 0.68
83 0.6
84 0.55
85 0.48
86 0.43
87 0.41
88 0.34
89 0.35
90 0.37
91 0.38
92 0.44
93 0.45
94 0.43
95 0.45
96 0.44
97 0.47
98 0.52
99 0.56
100 0.53
101 0.58
102 0.58
103 0.58
104 0.6