Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2EY94

Protein Details
Accession A0A2I2EY94    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKKRERKRRKKMEYEAPLDSLBasic
NLS Segment(s)
PositionSequence
2-11KKRERKRRKK
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022085  OpdG  
Pfam View protein in Pfam  
PF12311  DUF3632  
Amino Acid Sequences MKKRERKRRKKMEYEAPLDSLATVNGWAQGSPTRPFISIVSLYMAQQMDVNSAVEEIVSVLNVKYQLGDMNIIGEYLTDLWHTTLHTSKKTPHKDLSSPQPDQPTPTQSHLLTLLRTLKTQPPPPAIPQKHPPPPTQPSALVWADLPLFAQSVRSALRDAPGLGRCGFSEAEAAGWENFTAFVALVARDVLPPSPLEYSGGGAGSGSAGLEGVAVRMIRLALEERHDGGSSVYEDGAGVDGDAAVDAEILLGGAASAAAAAATTTTSAGGGTADESRRASQVIPTYEKADEVTKLNVYVACAALWAIIMGEELWERKGDKVGSVVGITVTTGNRRQSLFREGIPLRRWEMWTNRLEFLSRRGDLRIETRELAAEGAAVMRRVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.83
3 0.73
4 0.63
5 0.51
6 0.41
7 0.3
8 0.2
9 0.14
10 0.1
11 0.08
12 0.1
13 0.11
14 0.1
15 0.11
16 0.15
17 0.18
18 0.2
19 0.24
20 0.23
21 0.23
22 0.25
23 0.25
24 0.27
25 0.24
26 0.23
27 0.22
28 0.21
29 0.21
30 0.23
31 0.22
32 0.16
33 0.17
34 0.16
35 0.14
36 0.14
37 0.14
38 0.09
39 0.09
40 0.09
41 0.07
42 0.07
43 0.06
44 0.05
45 0.05
46 0.05
47 0.05
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.1
54 0.1
55 0.12
56 0.1
57 0.11
58 0.11
59 0.1
60 0.1
61 0.08
62 0.07
63 0.06
64 0.06
65 0.05
66 0.05
67 0.06
68 0.07
69 0.08
70 0.09
71 0.16
72 0.2
73 0.24
74 0.26
75 0.34
76 0.44
77 0.52
78 0.56
79 0.58
80 0.6
81 0.62
82 0.66
83 0.69
84 0.68
85 0.62
86 0.59
87 0.58
88 0.51
89 0.5
90 0.47
91 0.41
92 0.36
93 0.37
94 0.37
95 0.3
96 0.31
97 0.31
98 0.28
99 0.22
100 0.23
101 0.26
102 0.22
103 0.23
104 0.24
105 0.28
106 0.33
107 0.38
108 0.4
109 0.4
110 0.42
111 0.48
112 0.56
113 0.52
114 0.51
115 0.54
116 0.57
117 0.59
118 0.6
119 0.58
120 0.55
121 0.57
122 0.55
123 0.51
124 0.43
125 0.36
126 0.38
127 0.35
128 0.27
129 0.21
130 0.18
131 0.14
132 0.13
133 0.11
134 0.06
135 0.06
136 0.05
137 0.06
138 0.05
139 0.06
140 0.07
141 0.08
142 0.09
143 0.09
144 0.1
145 0.1
146 0.11
147 0.14
148 0.14
149 0.16
150 0.15
151 0.15
152 0.14
153 0.16
154 0.15
155 0.11
156 0.1
157 0.08
158 0.07
159 0.07
160 0.08
161 0.05
162 0.05
163 0.05
164 0.04
165 0.04
166 0.04
167 0.04
168 0.03
169 0.03
170 0.04
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.06
181 0.07
182 0.07
183 0.08
184 0.08
185 0.08
186 0.08
187 0.08
188 0.06
189 0.05
190 0.05
191 0.04
192 0.03
193 0.03
194 0.02
195 0.02
196 0.02
197 0.02
198 0.02
199 0.02
200 0.03
201 0.03
202 0.03
203 0.04
204 0.04
205 0.04
206 0.04
207 0.06
208 0.07
209 0.1
210 0.11
211 0.12
212 0.13
213 0.13
214 0.13
215 0.11
216 0.12
217 0.1
218 0.09
219 0.08
220 0.07
221 0.07
222 0.06
223 0.07
224 0.05
225 0.04
226 0.03
227 0.03
228 0.03
229 0.03
230 0.03
231 0.02
232 0.02
233 0.02
234 0.02
235 0.02
236 0.02
237 0.02
238 0.02
239 0.02
240 0.02
241 0.02
242 0.02
243 0.02
244 0.01
245 0.01
246 0.02
247 0.02
248 0.02
249 0.02
250 0.03
251 0.03
252 0.03
253 0.03
254 0.03
255 0.04
256 0.04
257 0.04
258 0.05
259 0.08
260 0.09
261 0.11
262 0.12
263 0.13
264 0.14
265 0.15
266 0.14
267 0.15
268 0.21
269 0.25
270 0.28
271 0.29
272 0.31
273 0.3
274 0.3
275 0.27
276 0.23
277 0.19
278 0.17
279 0.18
280 0.16
281 0.16
282 0.17
283 0.17
284 0.15
285 0.15
286 0.13
287 0.1
288 0.09
289 0.09
290 0.08
291 0.07
292 0.06
293 0.04
294 0.03
295 0.04
296 0.03
297 0.04
298 0.05
299 0.06
300 0.07
301 0.08
302 0.09
303 0.11
304 0.16
305 0.16
306 0.17
307 0.19
308 0.2
309 0.2
310 0.19
311 0.18
312 0.13
313 0.13
314 0.11
315 0.11
316 0.1
317 0.13
318 0.17
319 0.2
320 0.23
321 0.25
322 0.28
323 0.3
324 0.37
325 0.37
326 0.34
327 0.4
328 0.4
329 0.46
330 0.47
331 0.47
332 0.43
333 0.43
334 0.45
335 0.43
336 0.48
337 0.49
338 0.52
339 0.52
340 0.51
341 0.47
342 0.47
343 0.41
344 0.4
345 0.4
346 0.34
347 0.32
348 0.31
349 0.33
350 0.34
351 0.4
352 0.4
353 0.36
354 0.36
355 0.35
356 0.34
357 0.32
358 0.29
359 0.21
360 0.15
361 0.1
362 0.11
363 0.11