Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FHM8

Protein Details
Accession A0A2I2FHM8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
34-56MSRESRLKPWKDRQPRTQPQAIQHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, mito 6, plas 4
Family & Domain DBs
Amino Acid Sequences MLKRFSRALTLALVLALTLAFANAAIDGGSQGGMSRESRLKPWKDRQPRTQPQAIQLGVEEHFNDSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.06
4 0.04
5 0.03
6 0.03
7 0.02
8 0.02
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.05
21 0.05
22 0.07
23 0.1
24 0.11
25 0.17
26 0.25
27 0.3
28 0.38
29 0.48
30 0.57
31 0.65
32 0.72
33 0.78
34 0.81
35 0.85
36 0.84
37 0.82
38 0.74
39 0.68
40 0.68
41 0.58
42 0.47
43 0.37
44 0.33
45 0.25
46 0.24
47 0.19