Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FL94

Protein Details
Accession A0A2I2FL94    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
223-245AVLIWLYYRRRKRRRLDAAAAAAHydrophilic
NLS Segment(s)
PositionSequence
232-237RRKRRR
Subcellular Location(s) extr 12, plas 7, E.R. 3, nucl 2, cyto 1, pero 1, golg 1, mito_nucl 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000494  Rcpt_L-dom  
IPR036941  Rcpt_L-dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01030  Recep_L_domain  
Amino Acid Sequences MGRMDHFFLVLLGLASLPLVLAASKPDCSNPIEIRSQADATSLSSCDTISGTLTISSAASGSITLSNVETLRSGLTIDNTDRLESFIAPDLETVTGLLSVRNNKALASLQLESLGNVDGEVRIRANPHLTNLRLNELDQVAGGLYLDGPFDTISFPNLDSVQGATEITSSGSLNCDSLSPSEDNDNSDVFNGSFSCSNSSNTLSPGAKAGIAIAVIVVVAIIAVLIWLYYRRRKRRRLDAAAAAADKSPPSATPATPPDNDNKPSSDGDVDVEKDAPASIPRKPLSLPSPPPPPPPIGEGRNNLPPSLIPGIPRDVPQPPPSETDVPMLDSEHVHEAPGERDRERDAGPFELEAPVRGLHMRVLEPHVAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.04
5 0.03
6 0.03
7 0.03
8 0.04
9 0.08
10 0.1
11 0.12
12 0.13
13 0.15
14 0.18
15 0.2
16 0.27
17 0.28
18 0.31
19 0.35
20 0.35
21 0.37
22 0.38
23 0.37
24 0.29
25 0.26
26 0.22
27 0.19
28 0.2
29 0.16
30 0.13
31 0.13
32 0.12
33 0.11
34 0.11
35 0.1
36 0.09
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.08
43 0.08
44 0.06
45 0.06
46 0.05
47 0.05
48 0.06
49 0.07
50 0.07
51 0.08
52 0.08
53 0.1
54 0.1
55 0.1
56 0.09
57 0.09
58 0.09
59 0.08
60 0.09
61 0.08
62 0.1
63 0.13
64 0.14
65 0.17
66 0.17
67 0.18
68 0.17
69 0.17
70 0.16
71 0.13
72 0.14
73 0.15
74 0.15
75 0.14
76 0.14
77 0.14
78 0.13
79 0.13
80 0.11
81 0.06
82 0.07
83 0.06
84 0.07
85 0.09
86 0.13
87 0.15
88 0.17
89 0.17
90 0.16
91 0.18
92 0.19
93 0.18
94 0.18
95 0.18
96 0.15
97 0.17
98 0.17
99 0.15
100 0.14
101 0.12
102 0.07
103 0.07
104 0.07
105 0.05
106 0.06
107 0.07
108 0.07
109 0.07
110 0.09
111 0.1
112 0.14
113 0.14
114 0.18
115 0.23
116 0.24
117 0.28
118 0.28
119 0.31
120 0.27
121 0.26
122 0.24
123 0.19
124 0.17
125 0.12
126 0.11
127 0.07
128 0.07
129 0.06
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.04
138 0.05
139 0.05
140 0.06
141 0.07
142 0.07
143 0.08
144 0.08
145 0.08
146 0.07
147 0.07
148 0.07
149 0.06
150 0.06
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.07
165 0.09
166 0.08
167 0.09
168 0.11
169 0.11
170 0.12
171 0.13
172 0.12
173 0.1
174 0.1
175 0.1
176 0.07
177 0.07
178 0.06
179 0.06
180 0.07
181 0.08
182 0.1
183 0.11
184 0.12
185 0.13
186 0.15
187 0.15
188 0.15
189 0.18
190 0.16
191 0.15
192 0.15
193 0.13
194 0.11
195 0.1
196 0.09
197 0.06
198 0.05
199 0.05
200 0.03
201 0.03
202 0.03
203 0.02
204 0.02
205 0.01
206 0.01
207 0.01
208 0.01
209 0.01
210 0.01
211 0.01
212 0.01
213 0.02
214 0.04
215 0.07
216 0.15
217 0.24
218 0.35
219 0.45
220 0.55
221 0.65
222 0.74
223 0.83
224 0.85
225 0.83
226 0.8
227 0.76
228 0.69
229 0.6
230 0.49
231 0.38
232 0.28
233 0.21
234 0.14
235 0.09
236 0.06
237 0.1
238 0.12
239 0.12
240 0.18
241 0.23
242 0.27
243 0.28
244 0.3
245 0.32
246 0.36
247 0.38
248 0.35
249 0.31
250 0.3
251 0.3
252 0.3
253 0.25
254 0.19
255 0.18
256 0.19
257 0.17
258 0.15
259 0.15
260 0.12
261 0.11
262 0.11
263 0.1
264 0.12
265 0.13
266 0.15
267 0.22
268 0.23
269 0.25
270 0.25
271 0.31
272 0.32
273 0.4
274 0.42
275 0.41
276 0.5
277 0.51
278 0.55
279 0.52
280 0.49
281 0.41
282 0.41
283 0.42
284 0.39
285 0.43
286 0.42
287 0.43
288 0.49
289 0.48
290 0.42
291 0.36
292 0.3
293 0.28
294 0.29
295 0.25
296 0.18
297 0.2
298 0.25
299 0.26
300 0.27
301 0.25
302 0.25
303 0.29
304 0.32
305 0.34
306 0.32
307 0.35
308 0.39
309 0.39
310 0.37
311 0.36
312 0.32
313 0.3
314 0.27
315 0.24
316 0.2
317 0.17
318 0.18
319 0.18
320 0.17
321 0.15
322 0.16
323 0.16
324 0.19
325 0.25
326 0.27
327 0.23
328 0.25
329 0.29
330 0.31
331 0.31
332 0.32
333 0.29
334 0.29
335 0.3
336 0.29
337 0.26
338 0.27
339 0.25
340 0.21
341 0.2
342 0.16
343 0.16
344 0.16
345 0.16
346 0.14
347 0.18
348 0.18
349 0.2
350 0.25