Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2F194

Protein Details
Accession A0A2I2F194    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-55NTIKPKCTTQPNKPQPPPATHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025509  DUF4396  
Pfam View protein in Pfam  
PF14342  DUF4396  
Amino Acid Sequences MNRLKPNPHTLCTYNLRPTPRPTTPHLWKTPYIPLNTIKPKCTTQPNKPQPPPATTLTFWTCRHTWSRSAINTLRCLIGCTTGDFTALWTLQAYAPDWGMPLMMGVSMTTGLLTSLTLETVLLAYGKDALPLRHAVRTAAGMSLVSMLAMESVQNAVDWHLTGGVVDVADWAFWGKAAVSMAAGFAAPLPWNYWRLKALGVGCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.52
3 0.56
4 0.54
5 0.59
6 0.6
7 0.6
8 0.57
9 0.56
10 0.61
11 0.64
12 0.69
13 0.69
14 0.66
15 0.61
16 0.61
17 0.63
18 0.59
19 0.51
20 0.46
21 0.43
22 0.47
23 0.55
24 0.54
25 0.47
26 0.45
27 0.46
28 0.47
29 0.54
30 0.54
31 0.54
32 0.62
33 0.7
34 0.77
35 0.79
36 0.82
37 0.75
38 0.71
39 0.65
40 0.58
41 0.52
42 0.42
43 0.42
44 0.37
45 0.38
46 0.34
47 0.34
48 0.3
49 0.28
50 0.33
51 0.31
52 0.31
53 0.32
54 0.38
55 0.35
56 0.42
57 0.43
58 0.42
59 0.41
60 0.38
61 0.33
62 0.26
63 0.25
64 0.19
65 0.17
66 0.14
67 0.13
68 0.14
69 0.13
70 0.13
71 0.11
72 0.11
73 0.1
74 0.1
75 0.08
76 0.06
77 0.07
78 0.07
79 0.08
80 0.08
81 0.07
82 0.07
83 0.07
84 0.07
85 0.06
86 0.05
87 0.04
88 0.03
89 0.03
90 0.03
91 0.02
92 0.02
93 0.02
94 0.03
95 0.03
96 0.03
97 0.02
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.03
110 0.03
111 0.03
112 0.05
113 0.05
114 0.07
115 0.08
116 0.08
117 0.1
118 0.14
119 0.15
120 0.16
121 0.17
122 0.15
123 0.15
124 0.17
125 0.15
126 0.12
127 0.1
128 0.08
129 0.08
130 0.08
131 0.07
132 0.05
133 0.04
134 0.03
135 0.03
136 0.04
137 0.03
138 0.03
139 0.04
140 0.04
141 0.04
142 0.04
143 0.05
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.04
160 0.05
161 0.05
162 0.05
163 0.07
164 0.08
165 0.08
166 0.08
167 0.08
168 0.08
169 0.08
170 0.08
171 0.05
172 0.05
173 0.06
174 0.06
175 0.07
176 0.09
177 0.12
178 0.16
179 0.18
180 0.22
181 0.23
182 0.24
183 0.25
184 0.28