Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2F8A7

Protein Details
Accession A0A2I2F8A7    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
181-213QLATLERENSKRKKRKAIVPERRRRTSKPLRSSHydrophilic
NLS Segment(s)
PositionSequence
190-212SKRKKRKAIVPERRRRTSKPLRS
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MVYPFQPWSHNQASIRSTPSEASSSNHNVCLSFSFDSQYSATSITSITSVPPPPPPSPCTNDLTDITPRKCSFSTGYDLNNSCAFPSWPKRQSLLGESDCSTASAYVSDEDLGIDCAIPCDMTVDEESAAPQPTPAVGASLTTEQQIQMLRAAAEEEAQRARFLAQVQAHARAQQALRVAQLATLERENSKRKKRKAIVPERRRRTSKPLRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.39
4 0.36
5 0.31
6 0.32
7 0.28
8 0.25
9 0.22
10 0.26
11 0.31
12 0.31
13 0.33
14 0.3
15 0.27
16 0.27
17 0.28
18 0.24
19 0.19
20 0.17
21 0.17
22 0.17
23 0.19
24 0.18
25 0.17
26 0.14
27 0.13
28 0.12
29 0.1
30 0.1
31 0.08
32 0.09
33 0.08
34 0.08
35 0.11
36 0.13
37 0.14
38 0.19
39 0.23
40 0.25
41 0.29
42 0.32
43 0.34
44 0.38
45 0.4
46 0.39
47 0.36
48 0.37
49 0.34
50 0.34
51 0.35
52 0.36
53 0.34
54 0.36
55 0.34
56 0.34
57 0.33
58 0.32
59 0.29
60 0.26
61 0.29
62 0.26
63 0.28
64 0.29
65 0.3
66 0.29
67 0.27
68 0.23
69 0.18
70 0.16
71 0.15
72 0.15
73 0.21
74 0.28
75 0.31
76 0.33
77 0.34
78 0.36
79 0.38
80 0.37
81 0.37
82 0.3
83 0.28
84 0.27
85 0.26
86 0.23
87 0.21
88 0.17
89 0.1
90 0.08
91 0.06
92 0.06
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.03
107 0.04
108 0.04
109 0.05
110 0.06
111 0.06
112 0.07
113 0.07
114 0.08
115 0.08
116 0.09
117 0.07
118 0.07
119 0.06
120 0.06
121 0.07
122 0.06
123 0.06
124 0.05
125 0.05
126 0.07
127 0.08
128 0.09
129 0.08
130 0.08
131 0.07
132 0.09
133 0.1
134 0.09
135 0.09
136 0.1
137 0.09
138 0.09
139 0.1
140 0.08
141 0.09
142 0.09
143 0.1
144 0.11
145 0.12
146 0.12
147 0.12
148 0.12
149 0.12
150 0.13
151 0.18
152 0.17
153 0.24
154 0.26
155 0.3
156 0.3
157 0.3
158 0.3
159 0.27
160 0.25
161 0.21
162 0.22
163 0.19
164 0.19
165 0.19
166 0.18
167 0.15
168 0.17
169 0.16
170 0.15
171 0.16
172 0.17
173 0.19
174 0.25
175 0.33
176 0.41
177 0.51
178 0.58
179 0.65
180 0.75
181 0.81
182 0.85
183 0.87
184 0.89
185 0.89
186 0.91
187 0.93
188 0.91
189 0.92
190 0.88
191 0.83
192 0.83
193 0.83