Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FLM9

Protein Details
Accession A0A2I2FLM9    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-128PSSPEQAKKKRGRPAKKTKDTDEPAPKKVKKAVAKRTKKAKATADSHydrophilic
NLS Segment(s)
PositionSequence
89-123AKKKRGRPAKKTKDTDEPAPKKVKKAVAKRTKKAK
Subcellular Location(s) nucl 19, cyto 5, mito 2
Family & Domain DBs
Amino Acid Sequences MPMVWNDTADVKLFMAVLSTTNPKLNYQQLADIMGPGCTPSAIQHRIQRLKAMVANNDNATTNNGTNTNAEEATELATTTSVPSSPEQAKKKRGRPAKKTKDTDEPAPKKVKKAVAKRTKKAKATADSDETEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.08
5 0.1
6 0.13
7 0.14
8 0.17
9 0.19
10 0.2
11 0.24
12 0.28
13 0.29
14 0.27
15 0.29
16 0.27
17 0.28
18 0.26
19 0.23
20 0.18
21 0.14
22 0.12
23 0.09
24 0.08
25 0.05
26 0.06
27 0.07
28 0.14
29 0.17
30 0.21
31 0.26
32 0.35
33 0.41
34 0.42
35 0.42
36 0.36
37 0.36
38 0.36
39 0.34
40 0.29
41 0.26
42 0.27
43 0.24
44 0.23
45 0.2
46 0.17
47 0.16
48 0.14
49 0.11
50 0.11
51 0.11
52 0.11
53 0.11
54 0.11
55 0.11
56 0.09
57 0.09
58 0.08
59 0.07
60 0.08
61 0.07
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.04
69 0.06
70 0.06
71 0.11
72 0.16
73 0.24
74 0.32
75 0.38
76 0.48
77 0.56
78 0.63
79 0.68
80 0.73
81 0.76
82 0.79
83 0.84
84 0.86
85 0.87
86 0.87
87 0.83
88 0.83
89 0.78
90 0.77
91 0.76
92 0.7
93 0.67
94 0.7
95 0.66
96 0.61
97 0.62
98 0.61
99 0.6
100 0.65
101 0.69
102 0.7
103 0.79
104 0.83
105 0.87
106 0.88
107 0.85
108 0.83
109 0.81
110 0.79
111 0.75
112 0.73
113 0.68
114 0.6