Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2F3A3

Protein Details
Accession A0A2I2F3A3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
33-72NASKEREKKRGEKKEKLRKRKPTPSRTPRKKINVKAMMEGBasic
NLS Segment(s)
PositionSequence
36-64KEREKKRGEKKEKLRKRKPTPSRTPRKKI
Subcellular Location(s) mito 24.5, mito_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MHFPRASHQVGSSVPSVIKSFRFAVAVHVDGLNASKEREKKRGEKKEKLRKRKPTPSRTPRKKINVKAMMEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.15
5 0.15
6 0.16
7 0.16
8 0.16
9 0.17
10 0.15
11 0.19
12 0.2
13 0.19
14 0.17
15 0.15
16 0.14
17 0.12
18 0.13
19 0.1
20 0.07
21 0.07
22 0.1
23 0.16
24 0.2
25 0.27
26 0.32
27 0.4
28 0.51
29 0.62
30 0.68
31 0.73
32 0.8
33 0.84
34 0.9
35 0.92
36 0.91
37 0.91
38 0.92
39 0.93
40 0.93
41 0.92
42 0.93
43 0.93
44 0.94
45 0.94
46 0.93
47 0.92
48 0.92
49 0.91
50 0.9
51 0.9
52 0.87