Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FDJ5

Protein Details
Accession A0A2I2FDJ5   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
84-115KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MLSFRSVLRPSTGALRQLLPSMIRQPFSHVARPFTQLTRLSLGNGLRSLRAGKAQTENVSVASVGSTVRQIEQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.27
4 0.27
5 0.28
6 0.21
7 0.2
8 0.24
9 0.25
10 0.25
11 0.24
12 0.29
13 0.34
14 0.37
15 0.42
16 0.37
17 0.39
18 0.39
19 0.43
20 0.39
21 0.33
22 0.35
23 0.29
24 0.29
25 0.27
26 0.25
27 0.22
28 0.23
29 0.22
30 0.18
31 0.18
32 0.16
33 0.13
34 0.14
35 0.14
36 0.11
37 0.14
38 0.13
39 0.14
40 0.17
41 0.19
42 0.19
43 0.2
44 0.2
45 0.16
46 0.15
47 0.13
48 0.09
49 0.07
50 0.06
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.09
57 0.1
58 0.11
59 0.18
60 0.23
61 0.24
62 0.26
63 0.27
64 0.25
65 0.28
66 0.36
67 0.35
68 0.38
69 0.4
70 0.41
71 0.49
72 0.51
73 0.52
74 0.51
75 0.53
76 0.55
77 0.6
78 0.65
79 0.66
80 0.73
81 0.78
82 0.77
83 0.79
84 0.8
85 0.79
86 0.78
87 0.78
88 0.76
89 0.77
90 0.79
91 0.75
92 0.75
93 0.77
94 0.81
95 0.82