Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FCR6

Protein Details
Accession A0A2I2FCR6   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
342-361NSDEEQPRRRLNRGRKTLAFHydrophilic
NLS Segment(s)
PositionSequence
120-133TKSAGGTASRKRRK
221-249KPSRPRKKSTDGPSRKGAAKKPAPKAKGK
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037647  HIRIP3  
Amino Acid Sequences MAPRYALSESESGPDAEEAPAAPSGKTLEKALRDAVAAVYKSKKMEELTIKRIRLAAAKRLDLDEGFFKSSDWKGRSEQVIKDEVEVQDKAAQDSERGVDDDEGNGTAETPQKAKSTGRTKSAGGTASRKRRKETTPGSEDEAGESPSEEDVKKPTKKQAKTTQDKPSRKVSKDRVSDSSDGSNDDEDEGEEQQKPSEEPTTDAKADSESEMSVVLDEEPKPSRPRKKSTDGPSRKGAAKKPAPKAKGKDADPDPDQAEIKRLQGWLLKCGIRKMWARELAPYETPKAKIKHLKGMLKDAGMEGRYSVEKARQIQETRELQADLEMVQEGAKRWGKGSGDENSDEEQPRRRLNRGRKTLAFLDSDGEESD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.13
4 0.12
5 0.1
6 0.11
7 0.14
8 0.13
9 0.12
10 0.12
11 0.15
12 0.18
13 0.19
14 0.21
15 0.24
16 0.27
17 0.3
18 0.31
19 0.29
20 0.26
21 0.26
22 0.25
23 0.24
24 0.21
25 0.22
26 0.24
27 0.25
28 0.26
29 0.26
30 0.28
31 0.24
32 0.32
33 0.39
34 0.43
35 0.51
36 0.58
37 0.57
38 0.55
39 0.54
40 0.47
41 0.45
42 0.42
43 0.41
44 0.39
45 0.41
46 0.41
47 0.41
48 0.41
49 0.33
50 0.3
51 0.26
52 0.22
53 0.21
54 0.19
55 0.18
56 0.21
57 0.24
58 0.3
59 0.27
60 0.28
61 0.3
62 0.36
63 0.44
64 0.44
65 0.45
66 0.41
67 0.45
68 0.41
69 0.4
70 0.38
71 0.31
72 0.3
73 0.26
74 0.22
75 0.2
76 0.2
77 0.19
78 0.18
79 0.17
80 0.13
81 0.15
82 0.15
83 0.13
84 0.13
85 0.13
86 0.12
87 0.12
88 0.12
89 0.11
90 0.1
91 0.1
92 0.09
93 0.08
94 0.08
95 0.11
96 0.12
97 0.12
98 0.14
99 0.15
100 0.18
101 0.19
102 0.27
103 0.33
104 0.37
105 0.42
106 0.42
107 0.42
108 0.42
109 0.44
110 0.38
111 0.32
112 0.35
113 0.37
114 0.45
115 0.52
116 0.52
117 0.53
118 0.56
119 0.58
120 0.61
121 0.63
122 0.62
123 0.6
124 0.6
125 0.6
126 0.55
127 0.5
128 0.41
129 0.32
130 0.22
131 0.16
132 0.14
133 0.1
134 0.08
135 0.1
136 0.08
137 0.07
138 0.12
139 0.2
140 0.24
141 0.26
142 0.35
143 0.43
144 0.48
145 0.57
146 0.62
147 0.65
148 0.7
149 0.75
150 0.77
151 0.78
152 0.78
153 0.72
154 0.72
155 0.7
156 0.65
157 0.66
158 0.64
159 0.63
160 0.65
161 0.65
162 0.6
163 0.56
164 0.54
165 0.46
166 0.4
167 0.3
168 0.25
169 0.21
170 0.16
171 0.12
172 0.11
173 0.09
174 0.06
175 0.07
176 0.06
177 0.07
178 0.08
179 0.08
180 0.08
181 0.09
182 0.09
183 0.09
184 0.12
185 0.11
186 0.12
187 0.17
188 0.2
189 0.2
190 0.2
191 0.19
192 0.16
193 0.17
194 0.15
195 0.11
196 0.07
197 0.07
198 0.07
199 0.07
200 0.06
201 0.05
202 0.05
203 0.06
204 0.06
205 0.09
206 0.1
207 0.13
208 0.18
209 0.25
210 0.35
211 0.41
212 0.49
213 0.55
214 0.62
215 0.69
216 0.74
217 0.78
218 0.77
219 0.74
220 0.71
221 0.67
222 0.64
223 0.6
224 0.55
225 0.54
226 0.54
227 0.58
228 0.62
229 0.66
230 0.66
231 0.69
232 0.69
233 0.69
234 0.68
235 0.62
236 0.61
237 0.56
238 0.58
239 0.51
240 0.49
241 0.4
242 0.34
243 0.32
244 0.24
245 0.24
246 0.19
247 0.18
248 0.18
249 0.17
250 0.17
251 0.21
252 0.22
253 0.22
254 0.26
255 0.28
256 0.27
257 0.29
258 0.29
259 0.31
260 0.35
261 0.38
262 0.41
263 0.45
264 0.44
265 0.46
266 0.49
267 0.46
268 0.45
269 0.4
270 0.36
271 0.33
272 0.35
273 0.37
274 0.35
275 0.4
276 0.45
277 0.48
278 0.54
279 0.59
280 0.63
281 0.59
282 0.65
283 0.6
284 0.51
285 0.47
286 0.38
287 0.33
288 0.26
289 0.23
290 0.14
291 0.14
292 0.14
293 0.14
294 0.15
295 0.17
296 0.21
297 0.26
298 0.31
299 0.36
300 0.38
301 0.41
302 0.48
303 0.48
304 0.46
305 0.43
306 0.39
307 0.31
308 0.29
309 0.26
310 0.17
311 0.13
312 0.11
313 0.08
314 0.08
315 0.1
316 0.1
317 0.17
318 0.21
319 0.21
320 0.21
321 0.27
322 0.28
323 0.31
324 0.36
325 0.36
326 0.37
327 0.39
328 0.41
329 0.37
330 0.4
331 0.39
332 0.36
333 0.37
334 0.38
335 0.45
336 0.47
337 0.53
338 0.59
339 0.67
340 0.75
341 0.77
342 0.81
343 0.77
344 0.79
345 0.77
346 0.71
347 0.63
348 0.53
349 0.45
350 0.37