Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I2FIY9

Protein Details
Accession A0A2I2FIY9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-85ADNSLKTRSEKKERNKRYQDRGKKCKIGTHydrophilic
NLS Segment(s)
PositionSequence
67-73KKERNKR
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MYPFPQMQLTNQSINQSTNRYTQCFELCLRLPFRRQENSNPCTQNIGKARQTRETNADNSLKTRSEKKERNKRYQDRGKKCKIGTYTDHRRKDEQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.29
4 0.28
5 0.31
6 0.33
7 0.32
8 0.32
9 0.33
10 0.32
11 0.3
12 0.29
13 0.27
14 0.26
15 0.28
16 0.31
17 0.3
18 0.32
19 0.35
20 0.4
21 0.41
22 0.42
23 0.48
24 0.53
25 0.52
26 0.56
27 0.52
28 0.47
29 0.45
30 0.41
31 0.38
32 0.34
33 0.37
34 0.35
35 0.38
36 0.4
37 0.43
38 0.45
39 0.4
40 0.41
41 0.39
42 0.35
43 0.35
44 0.35
45 0.28
46 0.28
47 0.28
48 0.25
49 0.23
50 0.29
51 0.32
52 0.4
53 0.48
54 0.57
55 0.66
56 0.74
57 0.83
58 0.87
59 0.88
60 0.89
61 0.91
62 0.91
63 0.91
64 0.92
65 0.9
66 0.88
67 0.8
68 0.76
69 0.7
70 0.66
71 0.63
72 0.63
73 0.65
74 0.67
75 0.74
76 0.7