Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I2FEC0

Protein Details
Accession A0A2I2FEC0   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-70CRPTPTPSVKWREKKKSKKVPAWMILHydrophilic
NLS Segment(s)
PositionSequence
55-63WREKKKSKK
Subcellular Location(s) mito 15, nucl 9, golg 2
Family & Domain DBs
Amino Acid Sequences MDQRHPCIRIHIVHLPKPTHSDIFRFLPSMLECPANQISLSNQPCRPTPTPSVKWREKKKSKKVPAWMILQDPSCAAYVSPRPVSSILPMPCQHPLKHPSLTRSIQRISPGGEEKQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.52
3 0.48
4 0.49
5 0.46
6 0.42
7 0.37
8 0.35
9 0.34
10 0.36
11 0.35
12 0.31
13 0.28
14 0.26
15 0.25
16 0.23
17 0.2
18 0.17
19 0.16
20 0.19
21 0.2
22 0.17
23 0.15
24 0.14
25 0.15
26 0.21
27 0.25
28 0.24
29 0.25
30 0.27
31 0.28
32 0.35
33 0.35
34 0.31
35 0.35
36 0.4
37 0.45
38 0.51
39 0.58
40 0.6
41 0.67
42 0.71
43 0.75
44 0.76
45 0.8
46 0.84
47 0.86
48 0.87
49 0.87
50 0.86
51 0.84
52 0.79
53 0.74
54 0.65
55 0.56
56 0.49
57 0.41
58 0.32
59 0.23
60 0.18
61 0.13
62 0.11
63 0.09
64 0.1
65 0.13
66 0.17
67 0.19
68 0.18
69 0.2
70 0.21
71 0.22
72 0.21
73 0.26
74 0.23
75 0.26
76 0.27
77 0.27
78 0.33
79 0.36
80 0.34
81 0.34
82 0.38
83 0.38
84 0.45
85 0.47
86 0.45
87 0.5
88 0.55
89 0.54
90 0.55
91 0.52
92 0.48
93 0.48
94 0.46
95 0.41
96 0.41
97 0.4