Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MRZ2

Protein Details
Accession B8MRZ2   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-36KALAKLQPRIWRLRRRREVVRQRAPRLWRHydrophilic
NLS Segment(s)
PositionSequence
16-38RIWRLRRRREVVRQRAPRLWRAR
62-95SSPTKRGKPSKAATASSIKAPTKAKAKGRPSKSK
Subcellular Location(s) mito 13, nucl 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MPRSCLNKALAKLQPRIWRLRRRREVVRQRAPRLWRARNLLPPRNEVVLQKGASIAAASKTSSPTKRGKPSKAATASSIKAPTKAKAKGRPSKSKAVVVASTAESGSRSAKSSPQKTSSSTKKAAIPKKAAGAFPSRIGDIIELSSPEIEELRPDLAKDMRLGFLEIPHPRRFGENLMLVSTRAISAVKNYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.56
3 0.64
4 0.65
5 0.69
6 0.73
7 0.79
8 0.82
9 0.81
10 0.87
11 0.88
12 0.89
13 0.9
14 0.9
15 0.88
16 0.85
17 0.85
18 0.79
19 0.78
20 0.76
21 0.73
22 0.7
23 0.67
24 0.67
25 0.69
26 0.74
27 0.72
28 0.66
29 0.63
30 0.58
31 0.54
32 0.48
33 0.39
34 0.35
35 0.33
36 0.29
37 0.24
38 0.21
39 0.18
40 0.17
41 0.16
42 0.11
43 0.07
44 0.07
45 0.08
46 0.08
47 0.11
48 0.17
49 0.19
50 0.23
51 0.29
52 0.37
53 0.47
54 0.54
55 0.57
56 0.61
57 0.63
58 0.68
59 0.65
60 0.59
61 0.52
62 0.48
63 0.43
64 0.37
65 0.37
66 0.28
67 0.27
68 0.27
69 0.27
70 0.29
71 0.34
72 0.38
73 0.42
74 0.52
75 0.57
76 0.64
77 0.71
78 0.69
79 0.72
80 0.68
81 0.63
82 0.55
83 0.49
84 0.41
85 0.31
86 0.27
87 0.19
88 0.16
89 0.12
90 0.1
91 0.08
92 0.08
93 0.08
94 0.07
95 0.08
96 0.09
97 0.16
98 0.24
99 0.29
100 0.33
101 0.37
102 0.39
103 0.41
104 0.49
105 0.51
106 0.5
107 0.48
108 0.46
109 0.47
110 0.54
111 0.57
112 0.57
113 0.53
114 0.49
115 0.52
116 0.51
117 0.45
118 0.39
119 0.37
120 0.31
121 0.29
122 0.28
123 0.21
124 0.19
125 0.19
126 0.17
127 0.12
128 0.11
129 0.09
130 0.08
131 0.08
132 0.08
133 0.07
134 0.07
135 0.07
136 0.06
137 0.07
138 0.08
139 0.1
140 0.1
141 0.1
142 0.14
143 0.15
144 0.17
145 0.18
146 0.18
147 0.18
148 0.18
149 0.2
150 0.17
151 0.18
152 0.23
153 0.28
154 0.31
155 0.32
156 0.33
157 0.32
158 0.35
159 0.35
160 0.33
161 0.34
162 0.34
163 0.33
164 0.34
165 0.34
166 0.31
167 0.29
168 0.24
169 0.17
170 0.12
171 0.11
172 0.08