Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1E5B3

Protein Details
Accession A0A0D1E5B3    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
17-40WKNPWRLSSTRKNRVRQRLRAVDNHydrophilic
79-106KHDRGFRKSVHKVPKWTRKTIRENPVGYBasic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG uma:UMAG_11916  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGAFRPTLPSLGGLLWKNPWRLSSTRKNRVRQRLRAVDNVIATLEQSSVQCNSLSHAIASIKPESQMSPNDKYTTFSKHDRGFRKSVHKVPKWTRKTIRENPVGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.22
4 0.26
5 0.28
6 0.27
7 0.27
8 0.27
9 0.31
10 0.38
11 0.43
12 0.5
13 0.57
14 0.65
15 0.73
16 0.78
17 0.85
18 0.87
19 0.85
20 0.84
21 0.84
22 0.8
23 0.76
24 0.7
25 0.62
26 0.52
27 0.42
28 0.32
29 0.22
30 0.17
31 0.11
32 0.08
33 0.05
34 0.05
35 0.06
36 0.06
37 0.07
38 0.08
39 0.07
40 0.08
41 0.09
42 0.09
43 0.08
44 0.09
45 0.09
46 0.1
47 0.12
48 0.12
49 0.1
50 0.11
51 0.12
52 0.11
53 0.13
54 0.18
55 0.21
56 0.25
57 0.27
58 0.29
59 0.29
60 0.31
61 0.31
62 0.31
63 0.31
64 0.31
65 0.36
66 0.41
67 0.49
68 0.54
69 0.58
70 0.57
71 0.59
72 0.65
73 0.66
74 0.68
75 0.7
76 0.7
77 0.74
78 0.79
79 0.83
80 0.79
81 0.81
82 0.82
83 0.82
84 0.85
85 0.85
86 0.85