FuNGI

A0A2I2FFF7

Protein Details

Accession

A0A2I2FFF7

Localization Confidence

Medium

Confidence Score

10.5

NoLS Segment(s)

Position	Sequence	Protein Nature
432-481	LSEEVHRLLARRKKRKRRQSTVPVEKSCVTCRTRRTPEWRRGPSGNRDLC	Hydrophilic

NLS Segment(s)

Position	Sequence
441-449	ARRKKRKRR

Subcellular Location(s)

mito_nucl 9.166, nucl 9, mito 9, cyto_nucl 8.5

Family & Domain DBs

InterPro	View protein in InterPro IPR001610 PAC IPR000014 PAS IPR035965 PAS-like_dom_sf IPR013767 PAS_fold IPR013655 PAS_fold_3 IPR000679 Znf_GATA IPR013088 Znf_NHR/GATA
Gene Ontology	GO:0043565 F:sequence-specific DNA binding GO:0008270 F:zinc ion binding GO:0006355 P:regulation of DNA-templated transcription
Pfam	View protein in Pfam PF00320 GATA PF00989 PAS PF08447 PAS_3 PF13426 PAS_9
PROSITE	View protein in PROSITE PS00344 GATA_ZN_FINGER_1 PS50114 GATA_ZN_FINGER_2 PS50112 PAS
CDD	cd00130 PAS cd00202 ZnF_GATA

Amino Acid Sequences

MERKFVDPHTAFQLRTTIDERTEIQVSIINYRKGGQPFMNLVTMIPICLHSDDYRFYVGFQVDLVEKPDAVTRRNPNGSYMINYQRNQLPPYVVPPAVLYQAHPDLMTQFGPEQVSTILRSLDTHGPDYRGYLDRILVENADDVIHVMSFESELLYLSPSCRRCLAYEPVELVGKTLSMLCHPSDIGPVSRELWAQTTTDPICVAYRIRKKDSGYVWFESRGAWHIGQGRRQFMVLVGRVRPVYHLEQVVKLGGGALAETDIWIKLSASGIILFASSKVRPVLGRVPDDLVGKSLLDLVDAPQETRQALDTCYRGQEARLGHRIRHQKGHLLAARTTLFPGDVPAGGRPSFLVAQIHFPTTAAGDPSTSTTTQGDAPLEVSRHDPQQYPSDNQSMFTTWGQPPQPLFRELHPTRGSHWQFELRALAQHNQTLSEEVHRLLARRKKRKRRQSTVPVEKSCVTCRTRRTPEWRRGPSGNRDLCNSCGLRWAKQVRIGQASERVS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.32
2	0.35
3	0.34
4	0.29
5	0.26
6	0.29
7	0.3
8	0.29
9	0.3
10	0.26
11	0.23
12	0.23
13	0.23
14	0.28
15	0.32
16	0.29
17	0.27
18	0.29
19	0.35
20	0.34
21	0.38
22	0.32
23	0.32
24	0.35
25	0.38
26	0.38
27	0.31
28	0.29
29	0.28
30	0.25
31	0.19
32	0.15
33	0.13
34	0.12
35	0.13
36	0.16
37	0.14
38	0.17
39	0.19
40	0.21
41	0.23
42	0.21
43	0.21
44	0.23
45	0.21
46	0.18
47	0.16
48	0.16
49	0.14
50	0.15
51	0.18
52	0.13
53	0.13
54	0.13
55	0.18
56	0.19
57	0.21
58	0.28
59	0.33
60	0.42
61	0.48
62	0.48
63	0.46
64	0.49
65	0.48
66	0.45
67	0.44
68	0.44
69	0.45
70	0.45
71	0.46
72	0.47
73	0.48
74	0.45
75	0.41
76	0.35
77	0.29
78	0.33
79	0.33
80	0.28
81	0.24
82	0.24
83	0.23
84	0.22
85	0.21
86	0.17
87	0.17
88	0.19
89	0.19
90	0.17
91	0.16
92	0.14
93	0.15
94	0.15
95	0.11
96	0.09
97	0.11
98	0.12
99	0.11
100	0.11
101	0.1
102	0.12
103	0.12
104	0.12
105	0.11
106	0.1
107	0.11
108	0.15
109	0.19
110	0.2
111	0.22
112	0.23
113	0.24
114	0.24
115	0.25
116	0.24
117	0.22
118	0.21
119	0.19
120	0.18
121	0.19
122	0.2
123	0.2
124	0.16
125	0.13
126	0.13
127	0.12
128	0.1
129	0.08
130	0.06
131	0.06
132	0.05
133	0.05
134	0.04
135	0.04
136	0.04
137	0.04
138	0.04
139	0.04
140	0.04
141	0.05
142	0.06
143	0.06
144	0.07
145	0.14
146	0.15
147	0.16
148	0.18
149	0.2
150	0.2
151	0.26
152	0.33
153	0.31
154	0.33
155	0.33
156	0.32
157	0.32
158	0.29
159	0.24
160	0.16
161	0.11
162	0.08
163	0.08
164	0.06
165	0.06
166	0.09
167	0.08
168	0.09
169	0.09
170	0.1
171	0.11
172	0.12
173	0.12
174	0.11
175	0.12
176	0.12
177	0.13
178	0.13
179	0.12
180	0.12
181	0.12
182	0.12
183	0.11
184	0.14
185	0.14
186	0.14
187	0.13
188	0.12
189	0.11
190	0.11
191	0.13
192	0.17
193	0.24
194	0.29
195	0.33
196	0.37
197	0.38
198	0.44
199	0.48
200	0.47
201	0.45
202	0.42
203	0.4
204	0.36
205	0.34
206	0.27
207	0.23
208	0.18
209	0.15
210	0.12
211	0.13
212	0.19
213	0.21
214	0.27
215	0.29
216	0.29
217	0.27
218	0.27
219	0.24
220	0.19
221	0.21
222	0.18
223	0.18
224	0.17
225	0.18
226	0.18
227	0.18
228	0.17
229	0.16
230	0.16
231	0.15
232	0.18
233	0.17
234	0.18
235	0.18
236	0.17
237	0.14
238	0.11
239	0.08
240	0.06
241	0.04
242	0.03
243	0.03
244	0.03
245	0.03
246	0.03
247	0.03
248	0.03
249	0.03
250	0.04
251	0.04
252	0.04
253	0.05
254	0.05
255	0.05
256	0.05
257	0.05
258	0.05
259	0.05
260	0.04
261	0.05
262	0.07
263	0.06
264	0.07
265	0.07
266	0.08
267	0.08
268	0.12
269	0.18
270	0.21
271	0.23
272	0.23
273	0.24
274	0.25
275	0.26
276	0.23
277	0.17
278	0.13
279	0.1
280	0.09
281	0.09
282	0.07
283	0.06
284	0.06
285	0.06
286	0.09
287	0.09
288	0.1
289	0.09
290	0.1
291	0.1
292	0.1
293	0.12
294	0.09
295	0.1
296	0.14
297	0.15
298	0.15
299	0.17
300	0.17
301	0.16
302	0.15
303	0.18
304	0.18
305	0.22
306	0.3
307	0.3
308	0.3
309	0.37
310	0.47
311	0.46
312	0.5
313	0.46
314	0.44
315	0.46
316	0.53
317	0.49
318	0.43
319	0.4
320	0.36
321	0.35
322	0.29
323	0.26
324	0.18
325	0.14
326	0.1
327	0.11
328	0.08
329	0.08
330	0.08
331	0.09
332	0.12
333	0.12
334	0.12
335	0.1
336	0.12
337	0.12
338	0.12
339	0.13
340	0.11
341	0.17
342	0.18
343	0.19
344	0.16
345	0.16
346	0.15
347	0.14
348	0.14
349	0.09
350	0.08
351	0.08
352	0.08
353	0.11
354	0.13
355	0.12
356	0.13
357	0.12
358	0.13
359	0.14
360	0.16
361	0.14
362	0.12
363	0.13
364	0.14
365	0.14
366	0.13
367	0.16
368	0.16
369	0.19
370	0.21
371	0.22
372	0.23
373	0.32
374	0.35
375	0.36
376	0.38
377	0.41
378	0.39
379	0.37
380	0.36
381	0.29
382	0.28
383	0.24
384	0.25
385	0.2
386	0.26
387	0.26
388	0.27
389	0.28
390	0.32
391	0.35
392	0.32
393	0.33
394	0.3
395	0.39
396	0.38
397	0.45
398	0.4
399	0.38
400	0.38
401	0.47
402	0.47
403	0.4
404	0.43
405	0.4
406	0.38
407	0.4
408	0.41
409	0.31
410	0.32
411	0.32
412	0.32
413	0.28
414	0.29
415	0.27
416	0.25
417	0.25
418	0.23
419	0.21
420	0.2
421	0.2
422	0.18
423	0.22
424	0.22
425	0.24
426	0.3
427	0.38
428	0.44
429	0.54
430	0.64
431	0.71
432	0.81
433	0.9
434	0.92
435	0.94
436	0.95
437	0.95
438	0.95
439	0.95
440	0.94
441	0.87
442	0.8
443	0.73
444	0.66
445	0.6
446	0.56
447	0.49
448	0.46
449	0.5
450	0.56
451	0.62
452	0.68
453	0.73
454	0.76
455	0.82
456	0.87
457	0.86
458	0.83
459	0.82
460	0.81
461	0.81
462	0.81
463	0.78
464	0.69
465	0.67
466	0.63
467	0.57
468	0.56
469	0.47
470	0.36
471	0.38
472	0.38
473	0.37
474	0.43
475	0.47
476	0.46
477	0.52
478	0.57
479	0.56
480	0.6
481	0.58
482	0.53

A0A2I2FFF7

3D AlphaFold-predicted Structure Viewer