Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1C183

Protein Details
Accession A0A2I1C183   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MHLRRRRKPFNIPVHWHKHHDBasic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 7, E.R. 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013096  Cupin_2  
IPR014710  RmlC-like_jellyroll  
IPR011051  RmlC_Cupin_sf  
Pfam View protein in Pfam  
PF07883  Cupin_2  
Amino Acid Sequences MHLRRRRKPFNIPVHWHKHHDEYITVVEGRITATLDGKDMIVKAGDPPLIIPRLHHLHGFHGFPGESCVFEERNLPPGDWKVLKVFDQLLVLIFGVIAKLFCDPAPKSFDKAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.82
3 0.76
4 0.69
5 0.64
6 0.58
7 0.51
8 0.42
9 0.35
10 0.33
11 0.3
12 0.27
13 0.2
14 0.16
15 0.14
16 0.13
17 0.1
18 0.08
19 0.06
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.08
28 0.06
29 0.06
30 0.06
31 0.08
32 0.08
33 0.07
34 0.08
35 0.1
36 0.12
37 0.12
38 0.11
39 0.14
40 0.17
41 0.18
42 0.19
43 0.17
44 0.18
45 0.21
46 0.21
47 0.17
48 0.14
49 0.14
50 0.12
51 0.15
52 0.12
53 0.09
54 0.09
55 0.11
56 0.11
57 0.11
58 0.14
59 0.12
60 0.18
61 0.19
62 0.18
63 0.19
64 0.2
65 0.25
66 0.23
67 0.23
68 0.2
69 0.21
70 0.22
71 0.22
72 0.21
73 0.18
74 0.18
75 0.16
76 0.14
77 0.12
78 0.11
79 0.09
80 0.07
81 0.05
82 0.05
83 0.05
84 0.04
85 0.04
86 0.05
87 0.06
88 0.07
89 0.13
90 0.14
91 0.19
92 0.27
93 0.29