Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1CM05

Protein Details
Accession A0A2I1CM05    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29VNVPKTRRTYCKSKECHKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences VNVPKTRRTYCKSKECHKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTACKAKKQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.86
4 0.85
5 0.86
6 0.86
7 0.88
8 0.84
9 0.83
10 0.82
11 0.75
12 0.74
13 0.69
14 0.64
15 0.56
16 0.52
17 0.42
18 0.37
19 0.35
20 0.34
21 0.33
22 0.29
23 0.35
24 0.38
25 0.43
26 0.48
27 0.52
28 0.49
29 0.55
30 0.62
31 0.6
32 0.61
33 0.6
34 0.59
35 0.57
36 0.59
37 0.5
38 0.45
39 0.41
40 0.34
41 0.35
42 0.37
43 0.35
44 0.3
45 0.37
46 0.41
47 0.49
48 0.58
49 0.61
50 0.61
51 0.64
52 0.71
53 0.72
54 0.7
55 0.67
56 0.62
57 0.59
58 0.57
59 0.51
60 0.46
61 0.46
62 0.4
63 0.37
64 0.36
65 0.36
66 0.38
67 0.47
68 0.52
69 0.53
70 0.63
71 0.68
72 0.74
73 0.75
74 0.71
75 0.65
76 0.58
77 0.56
78 0.56
79 0.56
80 0.54
81 0.54
82 0.51
83 0.49
84 0.48
85 0.42