Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1C5U5

Protein Details
Accession A0A2I1C5U5   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
81-112KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MLSIRSILGSSTRALRQLLPSQPFSHQFLSRSQSQLSRVSVGNSLQSLRSAKKQDTNVGVVGSTVRQLEQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.26
4 0.32
5 0.38
6 0.37
7 0.39
8 0.39
9 0.41
10 0.42
11 0.41
12 0.38
13 0.33
14 0.3
15 0.32
16 0.34
17 0.34
18 0.33
19 0.3
20 0.29
21 0.3
22 0.33
23 0.29
24 0.28
25 0.24
26 0.23
27 0.23
28 0.21
29 0.19
30 0.14
31 0.14
32 0.11
33 0.12
34 0.13
35 0.13
36 0.18
37 0.2
38 0.21
39 0.26
40 0.29
41 0.31
42 0.32
43 0.33
44 0.28
45 0.24
46 0.22
47 0.16
48 0.14
49 0.1
50 0.08
51 0.06
52 0.05
53 0.07
54 0.08
55 0.09
56 0.16
57 0.21
58 0.22
59 0.24
60 0.25
61 0.25
62 0.28
63 0.36
64 0.34
65 0.38
66 0.4
67 0.41
68 0.49
69 0.51
70 0.51
71 0.5
72 0.52
73 0.54
74 0.6
75 0.65
76 0.66
77 0.73
78 0.78
79 0.77
80 0.79
81 0.8
82 0.79
83 0.78
84 0.78
85 0.76
86 0.77
87 0.79
88 0.75
89 0.75
90 0.77
91 0.81
92 0.82