Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1BU64

Protein Details
Accession A0A2I1BU64    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-98DPDSDQCQRRKIKVKRPCPSTTVHydrophilic
NLS Segment(s)
PositionSequence
47-51KRRKR
Subcellular Location(s) nucl 17, mito_nucl 11.833, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MPSKPAAPSGTGMTGSWLKDKGTADRQHPQHEDSHSDGNDLDHPTPKRRKRGKYVSMAWYCEFLPVTFFHKSVDTDPDSDQCQRRKIKVKRPCPSTTVCNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.21
4 0.19
5 0.17
6 0.2
7 0.22
8 0.25
9 0.32
10 0.37
11 0.39
12 0.47
13 0.5
14 0.54
15 0.54
16 0.49
17 0.45
18 0.42
19 0.41
20 0.35
21 0.37
22 0.29
23 0.28
24 0.26
25 0.22
26 0.22
27 0.2
28 0.17
29 0.17
30 0.19
31 0.26
32 0.35
33 0.41
34 0.48
35 0.55
36 0.62
37 0.67
38 0.76
39 0.77
40 0.77
41 0.77
42 0.76
43 0.71
44 0.65
45 0.55
46 0.46
47 0.37
48 0.29
49 0.23
50 0.13
51 0.11
52 0.1
53 0.14
54 0.14
55 0.14
56 0.14
57 0.15
58 0.17
59 0.18
60 0.23
61 0.21
62 0.22
63 0.23
64 0.24
65 0.26
66 0.3
67 0.34
68 0.33
69 0.39
70 0.43
71 0.51
72 0.59
73 0.66
74 0.71
75 0.75
76 0.81
77 0.83
78 0.85
79 0.81
80 0.76
81 0.73