Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1CEB5

Protein Details
Accession A0A2I1CEB5    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
35-60PQTHHEPYHRPPCRRRPQPLHIFYNAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MQPLTTSPQLEYHPYRRSRPTANSTKPQSSSPPSPQTHHEPYHRPPCRRRPQPLHIFYNADIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.53
4 0.56
5 0.56
6 0.58
7 0.6
8 0.62
9 0.65
10 0.68
11 0.67
12 0.66
13 0.61
14 0.54
15 0.49
16 0.44
17 0.43
18 0.41
19 0.43
20 0.41
21 0.41
22 0.43
23 0.46
24 0.47
25 0.46
26 0.46
27 0.43
28 0.49
29 0.58
30 0.62
31 0.62
32 0.65
33 0.71
34 0.77
35 0.8
36 0.83
37 0.82
38 0.85
39 0.89
40 0.88
41 0.84
42 0.78
43 0.73