Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8LX71

Protein Details
Accession B8LX71    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
12-37KADRTQQEQIRKRRHNLFKRLKEFNDHydrophilic
NLS Segment(s)
PositionSequence
23-25KRR
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MTSIAKGERKGKADRTQQEQIRKRRHNLFKRLKEFNDRYDISIWLTMEMPSGRIYTFNTNPERRIPTEEEITANKLPVVRKTPADYASSLPTIRDPPPFMLQRPLYDSNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.67
3 0.7
4 0.71
5 0.75
6 0.76
7 0.76
8 0.77
9 0.77
10 0.77
11 0.78
12 0.82
13 0.82
14 0.84
15 0.85
16 0.85
17 0.85
18 0.85
19 0.78
20 0.78
21 0.71
22 0.65
23 0.62
24 0.52
25 0.47
26 0.41
27 0.37
28 0.28
29 0.26
30 0.21
31 0.13
32 0.13
33 0.1
34 0.1
35 0.09
36 0.09
37 0.08
38 0.08
39 0.07
40 0.07
41 0.09
42 0.13
43 0.15
44 0.2
45 0.26
46 0.27
47 0.29
48 0.32
49 0.34
50 0.31
51 0.34
52 0.33
53 0.3
54 0.32
55 0.31
56 0.29
57 0.27
58 0.29
59 0.24
60 0.2
61 0.17
62 0.17
63 0.17
64 0.2
65 0.24
66 0.22
67 0.25
68 0.29
69 0.33
70 0.33
71 0.34
72 0.31
73 0.28
74 0.29
75 0.29
76 0.24
77 0.2
78 0.2
79 0.21
80 0.22
81 0.25
82 0.24
83 0.26
84 0.34
85 0.38
86 0.38
87 0.43
88 0.43
89 0.43
90 0.47