Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1BXQ2

Protein Details
Accession A0A2I1BXQ2    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
59-90RWSIWKRDIRHHKPEKVSSRQKRTYRDEQQFAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004045  Glutathione_S-Trfase_N  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF13417  GST_N_3  
Amino Acid Sequences MSSPQVILYAKWYSDCSARLRLALQLKDIKYVYMPVDEPNAAAYKEINPSGLVPTHSPRWSIWKRDIRHHKPEKVSSRQKRTYRDEQQFAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.24
4 0.27
5 0.28
6 0.27
7 0.27
8 0.31
9 0.34
10 0.32
11 0.32
12 0.33
13 0.32
14 0.35
15 0.34
16 0.29
17 0.22
18 0.23
19 0.19
20 0.15
21 0.15
22 0.11
23 0.14
24 0.13
25 0.13
26 0.11
27 0.11
28 0.09
29 0.09
30 0.08
31 0.08
32 0.1
33 0.1
34 0.09
35 0.08
36 0.09
37 0.1
38 0.11
39 0.1
40 0.1
41 0.13
42 0.18
43 0.18
44 0.19
45 0.18
46 0.27
47 0.32
48 0.36
49 0.43
50 0.47
51 0.49
52 0.59
53 0.7
54 0.68
55 0.74
56 0.78
57 0.76
58 0.76
59 0.82
60 0.81
61 0.81
62 0.83
63 0.83
64 0.84
65 0.85
66 0.84
67 0.84
68 0.83
69 0.84
70 0.83
71 0.83