Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8LUS1

Protein Details
Accession B8LUS1   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
77-106RETVFPTRGNKRVKRRRKHARKNHFIHLGRBasic
NLS Segment(s)
PositionSequence
84-98RGNKRVKRRRKHARK
Subcellular Location(s) nucl 15.5, cyto_nucl 13.5, cyto 10.5
Family & Domain DBs
Amino Acid Sequences MAQIKIDKELMAKESTKEYEKAQNMWREFCSYKGKDPIASVYDLEPLKDFVHHLAYGIEGRYDDEAAGQGSVKVFLRETVFPTRGNKRVKRRRKHARKNHFIHLGRQLWENDYHEYTKTIIRVSLWAQMLVYVFSSARLCEYLEGVSRANSRRGLYCKISRYQIRVIRNELSESELVFQVVKDAKGMTNAPEKRPEHELYEGLSTSSQYLLLNPMLPILAMLVASDRLRDYCTSKAVLAISAPPPDEVHVLEWKDPDCPLFEGLDDPSPILCTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.34
4 0.32
5 0.33
6 0.38
7 0.4
8 0.44
9 0.46
10 0.51
11 0.5
12 0.52
13 0.5
14 0.47
15 0.44
16 0.43
17 0.46
18 0.4
19 0.44
20 0.49
21 0.49
22 0.45
23 0.46
24 0.46
25 0.39
26 0.37
27 0.31
28 0.23
29 0.27
30 0.25
31 0.23
32 0.18
33 0.17
34 0.16
35 0.16
36 0.16
37 0.12
38 0.16
39 0.15
40 0.15
41 0.13
42 0.14
43 0.15
44 0.14
45 0.13
46 0.09
47 0.1
48 0.1
49 0.1
50 0.09
51 0.08
52 0.08
53 0.08
54 0.08
55 0.07
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.08
62 0.1
63 0.13
64 0.14
65 0.18
66 0.23
67 0.25
68 0.26
69 0.32
70 0.36
71 0.41
72 0.49
73 0.53
74 0.57
75 0.66
76 0.75
77 0.8
78 0.85
79 0.89
80 0.91
81 0.94
82 0.94
83 0.94
84 0.94
85 0.9
86 0.87
87 0.86
88 0.76
89 0.7
90 0.67
91 0.6
92 0.5
93 0.46
94 0.39
95 0.3
96 0.31
97 0.28
98 0.22
99 0.2
100 0.19
101 0.17
102 0.17
103 0.17
104 0.16
105 0.15
106 0.13
107 0.11
108 0.11
109 0.12
110 0.13
111 0.17
112 0.15
113 0.14
114 0.14
115 0.14
116 0.14
117 0.12
118 0.1
119 0.05
120 0.05
121 0.06
122 0.06
123 0.05
124 0.05
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.08
131 0.09
132 0.09
133 0.1
134 0.13
135 0.14
136 0.16
137 0.17
138 0.17
139 0.21
140 0.24
141 0.28
142 0.3
143 0.35
144 0.37
145 0.37
146 0.43
147 0.41
148 0.42
149 0.45
150 0.46
151 0.46
152 0.45
153 0.46
154 0.44
155 0.41
156 0.38
157 0.3
158 0.27
159 0.21
160 0.18
161 0.15
162 0.12
163 0.11
164 0.1
165 0.09
166 0.09
167 0.11
168 0.1
169 0.09
170 0.1
171 0.1
172 0.13
173 0.14
174 0.14
175 0.22
176 0.25
177 0.27
178 0.35
179 0.36
180 0.36
181 0.42
182 0.4
183 0.35
184 0.35
185 0.34
186 0.27
187 0.29
188 0.26
189 0.2
190 0.18
191 0.14
192 0.12
193 0.11
194 0.09
195 0.07
196 0.07
197 0.1
198 0.1
199 0.11
200 0.1
201 0.1
202 0.09
203 0.09
204 0.08
205 0.06
206 0.05
207 0.04
208 0.04
209 0.04
210 0.06
211 0.07
212 0.07
213 0.08
214 0.08
215 0.11
216 0.13
217 0.16
218 0.18
219 0.22
220 0.23
221 0.23
222 0.25
223 0.24
224 0.22
225 0.19
226 0.19
227 0.19
228 0.19
229 0.19
230 0.17
231 0.17
232 0.18
233 0.19
234 0.16
235 0.16
236 0.21
237 0.22
238 0.24
239 0.26
240 0.25
241 0.25
242 0.24
243 0.22
244 0.19
245 0.19
246 0.18
247 0.16
248 0.16
249 0.17
250 0.19
251 0.22
252 0.19
253 0.17
254 0.16