Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1CGN7

Protein Details
Accession A0A2I1CGN7   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MAAVKKRLKKPRLLSHTRPPTARAKNPKLSAKAHydrophilic
255-281LWEHDRRGKPRPFKKEVLNPGKTRNNFHydrophilic
NLS Segment(s)
PositionSequence
5-43KKRLKKPRLLSHTRPPTARAKNPKLSAKATRNLIRSHHR
261-268RGKPRPFK
Subcellular Location(s) mito 15, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR021867  Bmt2/SAMTOR  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0016433  F:rRNA (adenine) methyltransferase activity  
Pfam View protein in Pfam  
PF11968  Bmt2  
Amino Acid Sequences MAAVKKRLKKPRLLSHTRPPTARAKNPKLSAKATRNLIRSHHRLLKSRAQALKAGNEDLVREIDGRIQANGGLESYQLASKLGQSLERGGDSSKVLVDWIAPSLAQLKNSPYKLRMLEVGALSTENACSKNQCLDVTRIDLNAQEPGILKQDFMERPLPRVDDDRFHIISLSLVLNYVPNATGRGDMLKRCVEFLTDTPPAGSSITIRPSLFLVLPLACVKNSRYLTPSRLQEILSSMGFALAKNKETSKLIFQLWEHDRRGKPRPFKKEVLNPGKTRNNFAINVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.89
4 0.84
5 0.75
6 0.69
7 0.68
8 0.68
9 0.69
10 0.69
11 0.68
12 0.71
13 0.78
14 0.81
15 0.77
16 0.75
17 0.75
18 0.72
19 0.7
20 0.69
21 0.68
22 0.64
23 0.61
24 0.61
25 0.6
26 0.58
27 0.59
28 0.59
29 0.58
30 0.62
31 0.65
32 0.68
33 0.67
34 0.69
35 0.65
36 0.59
37 0.57
38 0.53
39 0.53
40 0.45
41 0.38
42 0.31
43 0.27
44 0.25
45 0.22
46 0.2
47 0.14
48 0.12
49 0.11
50 0.12
51 0.15
52 0.15
53 0.13
54 0.13
55 0.13
56 0.13
57 0.13
58 0.1
59 0.08
60 0.07
61 0.07
62 0.08
63 0.07
64 0.07
65 0.07
66 0.07
67 0.08
68 0.11
69 0.11
70 0.11
71 0.12
72 0.14
73 0.15
74 0.15
75 0.15
76 0.13
77 0.14
78 0.12
79 0.12
80 0.1
81 0.08
82 0.08
83 0.07
84 0.07
85 0.06
86 0.06
87 0.06
88 0.05
89 0.06
90 0.1
91 0.11
92 0.12
93 0.12
94 0.15
95 0.21
96 0.24
97 0.26
98 0.22
99 0.26
100 0.26
101 0.26
102 0.24
103 0.2
104 0.2
105 0.19
106 0.17
107 0.13
108 0.12
109 0.11
110 0.09
111 0.08
112 0.06
113 0.07
114 0.07
115 0.07
116 0.08
117 0.12
118 0.13
119 0.14
120 0.15
121 0.17
122 0.18
123 0.21
124 0.2
125 0.17
126 0.16
127 0.15
128 0.14
129 0.11
130 0.1
131 0.07
132 0.07
133 0.08
134 0.11
135 0.1
136 0.09
137 0.09
138 0.15
139 0.14
140 0.16
141 0.22
142 0.19
143 0.21
144 0.23
145 0.23
146 0.19
147 0.23
148 0.22
149 0.19
150 0.22
151 0.25
152 0.24
153 0.23
154 0.22
155 0.18
156 0.16
157 0.15
158 0.12
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.05
166 0.05
167 0.06
168 0.06
169 0.07
170 0.07
171 0.11
172 0.13
173 0.14
174 0.17
175 0.2
176 0.19
177 0.2
178 0.2
179 0.17
180 0.17
181 0.18
182 0.21
183 0.18
184 0.18
185 0.17
186 0.18
187 0.17
188 0.15
189 0.14
190 0.09
191 0.12
192 0.15
193 0.17
194 0.17
195 0.16
196 0.17
197 0.18
198 0.16
199 0.13
200 0.12
201 0.1
202 0.12
203 0.13
204 0.13
205 0.11
206 0.13
207 0.13
208 0.2
209 0.22
210 0.22
211 0.24
212 0.28
213 0.34
214 0.4
215 0.43
216 0.38
217 0.38
218 0.36
219 0.34
220 0.32
221 0.29
222 0.22
223 0.18
224 0.14
225 0.14
226 0.14
227 0.12
228 0.15
229 0.14
230 0.17
231 0.19
232 0.21
233 0.22
234 0.25
235 0.29
236 0.29
237 0.32
238 0.31
239 0.33
240 0.32
241 0.38
242 0.41
243 0.45
244 0.43
245 0.46
246 0.5
247 0.53
248 0.63
249 0.63
250 0.67
251 0.7
252 0.77
253 0.77
254 0.79
255 0.82
256 0.83
257 0.84
258 0.84
259 0.83
260 0.77
261 0.78
262 0.81
263 0.73
264 0.68
265 0.64
266 0.59