Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1BWJ9

Protein Details
Accession A0A2I1BWJ9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-40DSASNQQRKAPVRKRGVKRPKTQSSAPHydrophilic
NLS Segment(s)
PositionSequence
21-34RKAPVRKRGVKRPK
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MVSAKRKGLEGEDDSASNQQRKAPVRKRGVKRPKTQSSAPAQTTSAAADGSVLPQTHESVASSDQELQTPETPTPQPSKFWTNELRIALLVAVLKELDQTISEKTWHQVAETLRPMKPNISWNGARLEVGRLKREHFLNTTPAPSGRHDQPAQTSKDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.33
4 0.28
5 0.26
6 0.25
7 0.3
8 0.38
9 0.48
10 0.52
11 0.58
12 0.66
13 0.75
14 0.81
15 0.85
16 0.88
17 0.87
18 0.88
19 0.89
20 0.88
21 0.84
22 0.79
23 0.76
24 0.74
25 0.72
26 0.64
27 0.55
28 0.46
29 0.4
30 0.36
31 0.28
32 0.2
33 0.11
34 0.08
35 0.07
36 0.06
37 0.07
38 0.08
39 0.07
40 0.07
41 0.08
42 0.09
43 0.09
44 0.09
45 0.08
46 0.08
47 0.09
48 0.1
49 0.1
50 0.11
51 0.11
52 0.11
53 0.12
54 0.12
55 0.13
56 0.13
57 0.13
58 0.14
59 0.14
60 0.15
61 0.2
62 0.19
63 0.19
64 0.21
65 0.26
66 0.24
67 0.28
68 0.32
69 0.3
70 0.33
71 0.32
72 0.29
73 0.24
74 0.23
75 0.18
76 0.13
77 0.1
78 0.05
79 0.05
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.07
88 0.08
89 0.09
90 0.1
91 0.11
92 0.14
93 0.13
94 0.13
95 0.16
96 0.17
97 0.23
98 0.29
99 0.32
100 0.3
101 0.32
102 0.32
103 0.3
104 0.31
105 0.31
106 0.28
107 0.32
108 0.32
109 0.32
110 0.35
111 0.33
112 0.31
113 0.25
114 0.26
115 0.25
116 0.27
117 0.31
118 0.29
119 0.31
120 0.36
121 0.38
122 0.37
123 0.36
124 0.36
125 0.37
126 0.38
127 0.38
128 0.35
129 0.34
130 0.32
131 0.32
132 0.34
133 0.32
134 0.38
135 0.37
136 0.39
137 0.46
138 0.52
139 0.52