Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1C5U1

Protein Details
Accession A0A2I1C5U1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
116-139EEAATPTKPKRQRKTPAKKGAAATHydrophilic
NLS Segment(s)
PositionSequence
92-103PKKGQAKRKKAA
122-136TKPKRQRKTPAKKGA
Subcellular Location(s) cyto 21, nucl 5
Family & Domain DBs
Amino Acid Sequences MASPAKAKPEGILGLSAAEAKILMLGFLCITDQYKIDYEKLASKGGYTAGSANVMFNKAKRKLAELNADNSTKNGSSAAGEASSSKTATATPKKGQAKRKKAAAAADAEDGGAEGEEAATPTKPKRQRKTPAKKGAAATAKAGDDSVENGNGAPEVKPEPSKSEDIVKNEPMEEGNDDSELTVKVELDEVMNDADLDAELDALDAAQQDIKAEDHTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.1
5 0.08
6 0.06
7 0.05
8 0.06
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.06
15 0.06
16 0.05
17 0.07
18 0.08
19 0.09
20 0.11
21 0.14
22 0.16
23 0.17
24 0.19
25 0.19
26 0.25
27 0.26
28 0.26
29 0.23
30 0.21
31 0.21
32 0.2
33 0.19
34 0.13
35 0.12
36 0.11
37 0.12
38 0.12
39 0.11
40 0.11
41 0.13
42 0.12
43 0.14
44 0.22
45 0.24
46 0.29
47 0.29
48 0.33
49 0.38
50 0.44
51 0.52
52 0.46
53 0.47
54 0.46
55 0.46
56 0.41
57 0.34
58 0.29
59 0.19
60 0.16
61 0.12
62 0.08
63 0.08
64 0.09
65 0.09
66 0.07
67 0.07
68 0.08
69 0.09
70 0.09
71 0.09
72 0.08
73 0.07
74 0.09
75 0.16
76 0.22
77 0.25
78 0.26
79 0.35
80 0.43
81 0.49
82 0.58
83 0.62
84 0.66
85 0.67
86 0.71
87 0.66
88 0.61
89 0.58
90 0.51
91 0.43
92 0.34
93 0.29
94 0.22
95 0.17
96 0.14
97 0.11
98 0.07
99 0.04
100 0.03
101 0.02
102 0.02
103 0.02
104 0.03
105 0.03
106 0.04
107 0.05
108 0.06
109 0.14
110 0.23
111 0.33
112 0.42
113 0.51
114 0.62
115 0.73
116 0.83
117 0.86
118 0.89
119 0.85
120 0.81
121 0.72
122 0.69
123 0.63
124 0.53
125 0.43
126 0.35
127 0.29
128 0.24
129 0.22
130 0.14
131 0.09
132 0.1
133 0.1
134 0.08
135 0.08
136 0.08
137 0.08
138 0.08
139 0.08
140 0.06
141 0.07
142 0.08
143 0.11
144 0.13
145 0.14
146 0.19
147 0.22
148 0.25
149 0.25
150 0.32
151 0.35
152 0.38
153 0.42
154 0.4
155 0.37
156 0.35
157 0.34
158 0.26
159 0.23
160 0.19
161 0.16
162 0.14
163 0.13
164 0.13
165 0.12
166 0.13
167 0.12
168 0.1
169 0.09
170 0.08
171 0.08
172 0.09
173 0.09
174 0.08
175 0.08
176 0.09
177 0.08
178 0.08
179 0.08
180 0.07
181 0.07
182 0.06
183 0.06
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.05
193 0.06
194 0.06
195 0.07
196 0.09
197 0.1