Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1CKQ3

Protein Details
Accession A0A2I1CKQ3    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-43TISILCKRGRESRRKKREKRKIARLLGFCVHydrophilic
NLS Segment(s)
PositionSequence
20-36KRGRESRRKKREKRKIA
Subcellular Location(s) plas 14, mito 4, extr 3, E.R. 3, nucl 1, cyto 1, cyto_nucl 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVQRLNLFVVAPETISILCKRGRESRRKKREKRKIARLLGFCVIFSNGLFLSTSFQTLTVLELSRFPAARISIHQHHVSIFCAGGRTPRHSANRTPSSFRVLQPNVISLISDTEMDTSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.11
4 0.12
5 0.15
6 0.17
7 0.21
8 0.3
9 0.39
10 0.48
11 0.59
12 0.67
13 0.76
14 0.85
15 0.92
16 0.93
17 0.95
18 0.96
19 0.95
20 0.95
21 0.94
22 0.93
23 0.9
24 0.81
25 0.74
26 0.67
27 0.56
28 0.44
29 0.34
30 0.25
31 0.17
32 0.14
33 0.1
34 0.06
35 0.07
36 0.07
37 0.06
38 0.08
39 0.08
40 0.09
41 0.07
42 0.07
43 0.07
44 0.07
45 0.08
46 0.07
47 0.07
48 0.06
49 0.07
50 0.09
51 0.09
52 0.09
53 0.09
54 0.1
55 0.1
56 0.11
57 0.13
58 0.18
59 0.21
60 0.25
61 0.25
62 0.23
63 0.24
64 0.24
65 0.22
66 0.16
67 0.13
68 0.09
69 0.09
70 0.09
71 0.14
72 0.16
73 0.2
74 0.23
75 0.3
76 0.37
77 0.4
78 0.47
79 0.52
80 0.58
81 0.57
82 0.6
83 0.55
84 0.55
85 0.54
86 0.49
87 0.49
88 0.42
89 0.43
90 0.39
91 0.38
92 0.33
93 0.3
94 0.28
95 0.18
96 0.19
97 0.14
98 0.13
99 0.11