Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1C1J1

Protein Details
Accession A0A2I1C1J1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-47EDWTGIENRKQRKKVQNRINQRAHRKRVSEKKAQDPRSGRHydrophilic
NLS Segment(s)
PositionSequence
16-51RKQRKKVQNRINQRAHRKRVSEKKAQDPRSGRRPYR
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021833  DUF3425  
Pfam View protein in Pfam  
PF11905  DUF3425  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MDPEKNCEDWTGIENRKQRKKVQNRINQRAHRKRVSEKKAQDPRSGRRPYRVDRWRIANDKPSQPRNTEWTSTNVLAIRTSSQQTAGLAILAESDRSPNVHFPLPADHLLRLIHYNVYRALVSNKDVLRHFARIIIITPSDAVGNLQPSRRLCGGPTTIHPLSTGLPGSLFPTSLQMVHPHSNWIDMFPFPQIRDNLIQCEDSVDVVDFLRDLFGDMVNNSLSITPESSDPLPTSAQMLLQGEDDDDPVTAGRRGLIVWGEPYVKESWEATPGFLKKWACLLKGCEELIETSNRWRAIRGEDPLILAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.53
3 0.61
4 0.65
5 0.71
6 0.73
7 0.79
8 0.82
9 0.86
10 0.87
11 0.88
12 0.92
13 0.93
14 0.92
15 0.92
16 0.92
17 0.9
18 0.88
19 0.84
20 0.84
21 0.84
22 0.83
23 0.82
24 0.8
25 0.81
26 0.83
27 0.82
28 0.81
29 0.78
30 0.78
31 0.78
32 0.8
33 0.73
34 0.72
35 0.75
36 0.72
37 0.75
38 0.75
39 0.73
40 0.7
41 0.75
42 0.74
43 0.71
44 0.69
45 0.67
46 0.65
47 0.66
48 0.68
49 0.67
50 0.63
51 0.61
52 0.59
53 0.57
54 0.56
55 0.5
56 0.43
57 0.4
58 0.4
59 0.37
60 0.36
61 0.3
62 0.25
63 0.22
64 0.21
65 0.18
66 0.16
67 0.17
68 0.15
69 0.14
70 0.15
71 0.14
72 0.15
73 0.13
74 0.1
75 0.08
76 0.07
77 0.07
78 0.06
79 0.06
80 0.05
81 0.06
82 0.06
83 0.07
84 0.09
85 0.1
86 0.13
87 0.16
88 0.16
89 0.16
90 0.2
91 0.23
92 0.24
93 0.23
94 0.2
95 0.19
96 0.19
97 0.19
98 0.15
99 0.13
100 0.13
101 0.12
102 0.14
103 0.13
104 0.14
105 0.13
106 0.13
107 0.14
108 0.12
109 0.14
110 0.18
111 0.18
112 0.19
113 0.2
114 0.23
115 0.23
116 0.24
117 0.22
118 0.19
119 0.19
120 0.16
121 0.17
122 0.15
123 0.12
124 0.1
125 0.1
126 0.08
127 0.07
128 0.07
129 0.06
130 0.05
131 0.08
132 0.09
133 0.1
134 0.12
135 0.13
136 0.16
137 0.17
138 0.16
139 0.14
140 0.18
141 0.2
142 0.19
143 0.2
144 0.24
145 0.23
146 0.23
147 0.23
148 0.19
149 0.16
150 0.16
151 0.15
152 0.07
153 0.07
154 0.07
155 0.09
156 0.08
157 0.07
158 0.06
159 0.07
160 0.08
161 0.08
162 0.09
163 0.1
164 0.14
165 0.16
166 0.16
167 0.16
168 0.16
169 0.18
170 0.17
171 0.15
172 0.13
173 0.11
174 0.11
175 0.12
176 0.13
177 0.12
178 0.17
179 0.16
180 0.18
181 0.22
182 0.22
183 0.23
184 0.23
185 0.23
186 0.18
187 0.19
188 0.16
189 0.12
190 0.11
191 0.08
192 0.07
193 0.07
194 0.07
195 0.05
196 0.05
197 0.05
198 0.04
199 0.05
200 0.05
201 0.05
202 0.06
203 0.06
204 0.08
205 0.08
206 0.08
207 0.07
208 0.07
209 0.07
210 0.07
211 0.08
212 0.08
213 0.08
214 0.11
215 0.11
216 0.12
217 0.12
218 0.13
219 0.13
220 0.13
221 0.14
222 0.12
223 0.12
224 0.13
225 0.13
226 0.12
227 0.12
228 0.12
229 0.1
230 0.1
231 0.1
232 0.08
233 0.07
234 0.07
235 0.06
236 0.08
237 0.08
238 0.08
239 0.08
240 0.08
241 0.08
242 0.1
243 0.11
244 0.11
245 0.11
246 0.14
247 0.14
248 0.14
249 0.17
250 0.16
251 0.15
252 0.15
253 0.15
254 0.15
255 0.2
256 0.2
257 0.19
258 0.25
259 0.26
260 0.26
261 0.3
262 0.29
263 0.24
264 0.33
265 0.36
266 0.32
267 0.35
268 0.38
269 0.4
270 0.44
271 0.43
272 0.35
273 0.31
274 0.31
275 0.29
276 0.28
277 0.23
278 0.24
279 0.29
280 0.31
281 0.3
282 0.31
283 0.31
284 0.35
285 0.41
286 0.41
287 0.4
288 0.39