Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1CPD1

Protein Details
Accession A0A2I1CPD1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VLAKKHVPIVKKRTKRFFRHQSDRFKCVPESWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
12-17KKRTKR
34-48RKPKGIDNRVRRRFK
Subcellular Location(s) mito 20, cyto 5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVLAKKHVPIVKKRTKRFFRHQSDRFKCVPESWRKPKGIDNRVRRRFKGNIPMPSIGYGSNKKTKHMMPSGHKAFLVHNPKDVELLLMHNRTYAAEIASAVSSRKRVDIIAKAKALGVKVTNPKGRVTVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.87
4 0.88
5 0.89
6 0.89
7 0.9
8 0.89
9 0.89
10 0.86
11 0.83
12 0.74
13 0.67
14 0.58
15 0.52
16 0.53
17 0.52
18 0.56
19 0.59
20 0.64
21 0.63
22 0.63
23 0.66
24 0.67
25 0.67
26 0.66
27 0.68
28 0.7
29 0.78
30 0.82
31 0.76
32 0.72
33 0.68
34 0.66
35 0.66
36 0.62
37 0.59
38 0.58
39 0.57
40 0.51
41 0.46
42 0.39
43 0.29
44 0.24
45 0.2
46 0.19
47 0.25
48 0.25
49 0.25
50 0.28
51 0.29
52 0.32
53 0.35
54 0.38
55 0.37
56 0.46
57 0.48
58 0.45
59 0.43
60 0.37
61 0.33
62 0.34
63 0.37
64 0.27
65 0.29
66 0.29
67 0.29
68 0.29
69 0.27
70 0.2
71 0.12
72 0.15
73 0.15
74 0.15
75 0.15
76 0.15
77 0.15
78 0.14
79 0.15
80 0.12
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.08
88 0.09
89 0.11
90 0.12
91 0.13
92 0.13
93 0.14
94 0.2
95 0.29
96 0.34
97 0.39
98 0.4
99 0.39
100 0.39
101 0.39
102 0.34
103 0.28
104 0.23
105 0.24
106 0.31
107 0.39
108 0.43
109 0.43
110 0.44
111 0.45