Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8MPW5

Protein Details
Accession B8MPW5    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
288-309DSDAPRKSGKRQGKRRLQLTASHydrophilic
NLS Segment(s)
PositionSequence
293-302RKSGKRQGKR
Subcellular Location(s) mito 11, cyto 7.5, cyto_nucl 7, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002167  GDC-like  
IPR002067  Mit_carrier  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0055085  P:transmembrane transport  
Pfam View protein in Pfam  
PF00153  Mito_carr  
PROSITE View protein in PROSITE  
PS50920  SOLCAR  
Amino Acid Sequences MEVSRQASTLRSSGMSDNPEDATAPVAADRVLSKERTDNSTVTDVKPVDKRSLDYVLRSGLAGGLAGCAGKTVVAPLDRVKILFQASNPQFAKYSGSWSGLALAMRDIHKYEGSRGLFKGHSATLLRIFPYAAIKFLAYEQIRAVIIPSREKETPFRRLISGSLAGVTSVFFTYPLEVVRVRMAFETKRNARSSYTAICKQIYHEQASSRPVAASAGPNQSATMATAQTVSTSINAVTPRSGLANFYRGFAPTILGMIPYAGISFLTHDTVGDILRLPGLAQYTTIPDSDAPRKSGKRQGKRRLQLTASAELFSGAAAGLVSQTSAYPLEVIRRRMQVGGATGDGHRLSIAETARKIFLERGFRGFWVGLTIGYLKIIPMSATSFFVYERMKWYLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.28
4 0.28
5 0.27
6 0.26
7 0.24
8 0.2
9 0.17
10 0.13
11 0.12
12 0.1
13 0.09
14 0.09
15 0.09
16 0.1
17 0.12
18 0.16
19 0.17
20 0.19
21 0.25
22 0.29
23 0.34
24 0.37
25 0.34
26 0.35
27 0.41
28 0.41
29 0.36
30 0.39
31 0.33
32 0.35
33 0.4
34 0.38
35 0.38
36 0.37
37 0.38
38 0.37
39 0.45
40 0.42
41 0.39
42 0.38
43 0.34
44 0.32
45 0.29
46 0.24
47 0.16
48 0.14
49 0.11
50 0.08
51 0.06
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.08
61 0.09
62 0.11
63 0.13
64 0.18
65 0.18
66 0.19
67 0.18
68 0.18
69 0.19
70 0.2
71 0.18
72 0.24
73 0.25
74 0.34
75 0.34
76 0.32
77 0.31
78 0.29
79 0.34
80 0.24
81 0.28
82 0.22
83 0.24
84 0.23
85 0.22
86 0.23
87 0.2
88 0.19
89 0.14
90 0.12
91 0.12
92 0.12
93 0.13
94 0.13
95 0.12
96 0.15
97 0.16
98 0.18
99 0.23
100 0.24
101 0.27
102 0.26
103 0.28
104 0.26
105 0.26
106 0.25
107 0.18
108 0.19
109 0.17
110 0.18
111 0.18
112 0.19
113 0.19
114 0.17
115 0.16
116 0.14
117 0.18
118 0.16
119 0.13
120 0.13
121 0.12
122 0.12
123 0.12
124 0.19
125 0.14
126 0.15
127 0.14
128 0.15
129 0.15
130 0.14
131 0.15
132 0.11
133 0.13
134 0.16
135 0.17
136 0.2
137 0.21
138 0.23
139 0.3
140 0.32
141 0.39
142 0.39
143 0.39
144 0.36
145 0.36
146 0.35
147 0.31
148 0.27
149 0.18
150 0.15
151 0.13
152 0.12
153 0.11
154 0.1
155 0.06
156 0.05
157 0.04
158 0.04
159 0.04
160 0.05
161 0.06
162 0.06
163 0.07
164 0.07
165 0.08
166 0.1
167 0.1
168 0.1
169 0.1
170 0.13
171 0.13
172 0.16
173 0.24
174 0.26
175 0.31
176 0.32
177 0.33
178 0.32
179 0.33
180 0.34
181 0.31
182 0.33
183 0.31
184 0.31
185 0.3
186 0.29
187 0.28
188 0.31
189 0.28
190 0.25
191 0.23
192 0.23
193 0.25
194 0.27
195 0.25
196 0.19
197 0.16
198 0.13
199 0.12
200 0.11
201 0.11
202 0.12
203 0.14
204 0.14
205 0.14
206 0.14
207 0.14
208 0.13
209 0.11
210 0.09
211 0.06
212 0.06
213 0.07
214 0.07
215 0.06
216 0.07
217 0.06
218 0.05
219 0.06
220 0.06
221 0.08
222 0.08
223 0.09
224 0.08
225 0.08
226 0.09
227 0.09
228 0.09
229 0.09
230 0.1
231 0.16
232 0.16
233 0.17
234 0.17
235 0.16
236 0.17
237 0.16
238 0.15
239 0.09
240 0.09
241 0.08
242 0.07
243 0.06
244 0.05
245 0.05
246 0.04
247 0.04
248 0.03
249 0.03
250 0.03
251 0.05
252 0.06
253 0.07
254 0.07
255 0.07
256 0.07
257 0.08
258 0.08
259 0.07
260 0.06
261 0.05
262 0.06
263 0.06
264 0.05
265 0.06
266 0.07
267 0.07
268 0.07
269 0.08
270 0.1
271 0.12
272 0.11
273 0.11
274 0.11
275 0.16
276 0.22
277 0.24
278 0.25
279 0.31
280 0.35
281 0.41
282 0.49
283 0.55
284 0.59
285 0.67
286 0.75
287 0.79
288 0.84
289 0.84
290 0.82
291 0.74
292 0.71
293 0.65
294 0.61
295 0.51
296 0.43
297 0.37
298 0.29
299 0.26
300 0.18
301 0.13
302 0.05
303 0.04
304 0.03
305 0.03
306 0.03
307 0.03
308 0.04
309 0.04
310 0.04
311 0.05
312 0.06
313 0.06
314 0.07
315 0.08
316 0.17
317 0.22
318 0.27
319 0.31
320 0.34
321 0.36
322 0.36
323 0.37
324 0.32
325 0.3
326 0.28
327 0.23
328 0.21
329 0.2
330 0.22
331 0.2
332 0.16
333 0.12
334 0.1
335 0.1
336 0.13
337 0.16
338 0.18
339 0.2
340 0.23
341 0.24
342 0.24
343 0.25
344 0.26
345 0.29
346 0.33
347 0.35
348 0.37
349 0.38
350 0.38
351 0.39
352 0.34
353 0.28
354 0.23
355 0.2
356 0.15
357 0.15
358 0.16
359 0.12
360 0.13
361 0.12
362 0.09
363 0.09
364 0.09
365 0.08
366 0.08
367 0.11
368 0.12
369 0.15
370 0.16
371 0.15
372 0.15
373 0.2
374 0.21
375 0.2
376 0.24
377 0.26