Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1CFQ8

Protein Details
Accession A0A2I1CFQ8    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MYRPRASYKGRRQPMEKRYFLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.5, mito 12, nucl 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MYRPRASYKGRRQPMEKRYFLQEADYASYFCNWCNYCKVRSEKAVVNGIDHRRCGRCRTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.73
4 0.65
5 0.62
6 0.59
7 0.52
8 0.44
9 0.35
10 0.27
11 0.26
12 0.23
13 0.18
14 0.15
15 0.15
16 0.13
17 0.11
18 0.14
19 0.12
20 0.13
21 0.2
22 0.22
23 0.24
24 0.31
25 0.37
26 0.37
27 0.41
28 0.45
29 0.43
30 0.46
31 0.51
32 0.44
33 0.41
34 0.43
35 0.46
36 0.44
37 0.42
38 0.41
39 0.4
40 0.44