Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1CI25

Protein Details
Accession A0A2I1CI25    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26DVPHSYKLKPYRRWRPWSQRALPKGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.5, mito 12, nucl 11, cyto 4
Family & Domain DBs
Amino Acid Sequences DVPHSYKLKPYRRWRPWSQRALPKGGTLTFTNVEGAENIPLPNPVLQHCHFRIAEVLNASGMSEFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.89
4 0.9
5 0.88
6 0.86
7 0.8
8 0.77
9 0.68
10 0.58
11 0.5
12 0.4
13 0.33
14 0.24
15 0.23
16 0.17
17 0.16
18 0.15
19 0.12
20 0.11
21 0.09
22 0.09
23 0.07
24 0.07
25 0.06
26 0.06
27 0.06
28 0.07
29 0.08
30 0.08
31 0.09
32 0.14
33 0.16
34 0.23
35 0.24
36 0.3
37 0.29
38 0.29
39 0.31
40 0.27
41 0.3
42 0.24
43 0.23
44 0.17
45 0.17
46 0.17