Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1BXH4

Protein Details
Accession A0A2I1BXH4    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-39LASTSIPERRKPPKLRRKRPVSHALDEDHydrophilic
NLS Segment(s)
PositionSequence
20-31RRKPPKLRRKRP
Subcellular Location(s) nucl 22, cyto_nucl 14.833, mito_nucl 11.999
Family & Domain DBs
Amino Acid Sequences MVEPNTVGDADLASTSIPERRKPPKLRRKRPVSHALDEDVEKEKIVGTVSTQKQAVVSKTSDDESNFEDTLEGESSAIEAQLQPVPERQRQTIWSKPFRNEEKERDVAEDEDVPVAAERQRLRRGRRGEQTLIQSNTIDNAGRTVGQSSELVLNRTDGVVGTITDTSGRVLGRPSEKNEQLKKEDDEQLRLRLELNLDLEVQLKAKISGDLTLTLLLVFAPVHNEFGYSSLTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.12
4 0.15
5 0.19
6 0.27
7 0.37
8 0.48
9 0.58
10 0.68
11 0.74
12 0.83
13 0.9
14 0.92
15 0.94
16 0.93
17 0.92
18 0.92
19 0.88
20 0.84
21 0.77
22 0.69
23 0.61
24 0.52
25 0.44
26 0.37
27 0.29
28 0.22
29 0.17
30 0.15
31 0.13
32 0.13
33 0.11
34 0.1
35 0.2
36 0.22
37 0.25
38 0.24
39 0.24
40 0.25
41 0.28
42 0.27
43 0.22
44 0.21
45 0.19
46 0.21
47 0.22
48 0.22
49 0.19
50 0.19
51 0.18
52 0.2
53 0.18
54 0.16
55 0.15
56 0.14
57 0.15
58 0.14
59 0.11
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.05
66 0.04
67 0.05
68 0.07
69 0.08
70 0.08
71 0.12
72 0.17
73 0.21
74 0.24
75 0.24
76 0.25
77 0.3
78 0.36
79 0.39
80 0.43
81 0.48
82 0.5
83 0.53
84 0.58
85 0.59
86 0.6
87 0.58
88 0.56
89 0.54
90 0.54
91 0.5
92 0.44
93 0.39
94 0.32
95 0.26
96 0.2
97 0.14
98 0.1
99 0.09
100 0.07
101 0.06
102 0.06
103 0.06
104 0.08
105 0.1
106 0.15
107 0.22
108 0.29
109 0.34
110 0.41
111 0.47
112 0.52
113 0.58
114 0.61
115 0.57
116 0.55
117 0.56
118 0.55
119 0.5
120 0.42
121 0.34
122 0.27
123 0.24
124 0.2
125 0.14
126 0.07
127 0.07
128 0.06
129 0.07
130 0.07
131 0.07
132 0.06
133 0.08
134 0.08
135 0.08
136 0.13
137 0.13
138 0.14
139 0.13
140 0.14
141 0.13
142 0.13
143 0.12
144 0.06
145 0.07
146 0.06
147 0.06
148 0.07
149 0.06
150 0.06
151 0.07
152 0.07
153 0.06
154 0.08
155 0.08
156 0.07
157 0.09
158 0.14
159 0.2
160 0.24
161 0.29
162 0.35
163 0.42
164 0.5
165 0.56
166 0.58
167 0.56
168 0.57
169 0.56
170 0.53
171 0.56
172 0.5
173 0.5
174 0.47
175 0.48
176 0.44
177 0.4
178 0.35
179 0.28
180 0.27
181 0.23
182 0.21
183 0.17
184 0.16
185 0.16
186 0.17
187 0.15
188 0.14
189 0.12
190 0.1
191 0.1
192 0.11
193 0.12
194 0.12
195 0.14
196 0.15
197 0.15
198 0.15
199 0.15
200 0.14
201 0.12
202 0.11
203 0.08
204 0.07
205 0.06
206 0.05
207 0.09
208 0.09
209 0.12
210 0.11
211 0.12
212 0.12
213 0.14