Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1BUQ5

Protein Details
Accession A0A0D1BUQ5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
85-110MAQKMSAKRLARKKRRLGITKKVSHAHydrophilic
NLS Segment(s)
PositionSequence
28-107KKKTTPWEKKMEQRRKQDSIKQREREMKAEKESEAERKKQVTRERKQMAEEKARLEIMAQKMSAKRLARKKRRLGITKKV
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG uma:UMAG_11234  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSSKASYSSSDMLPPKSTSTTTVTIAGKKKTTPWEKKMEQRRKQDSIKQREREMKAEKESEAERKKQVTRERKQMAEEKARLEIMAQKMSAKRLARKKRRLGITKKVSHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.29
4 0.28
5 0.25
6 0.27
7 0.27
8 0.26
9 0.3
10 0.29
11 0.32
12 0.36
13 0.36
14 0.33
15 0.31
16 0.34
17 0.39
18 0.47
19 0.51
20 0.53
21 0.59
22 0.63
23 0.72
24 0.78
25 0.79
26 0.77
27 0.78
28 0.79
29 0.77
30 0.77
31 0.77
32 0.76
33 0.76
34 0.77
35 0.71
36 0.68
37 0.69
38 0.66
39 0.65
40 0.6
41 0.54
42 0.48
43 0.46
44 0.4
45 0.34
46 0.33
47 0.34
48 0.32
49 0.31
50 0.3
51 0.33
52 0.36
53 0.4
54 0.48
55 0.5
56 0.54
57 0.61
58 0.64
59 0.62
60 0.64
61 0.64
62 0.63
63 0.61
64 0.56
65 0.48
66 0.44
67 0.41
68 0.36
69 0.29
70 0.27
71 0.22
72 0.22
73 0.2
74 0.22
75 0.24
76 0.26
77 0.32
78 0.31
79 0.36
80 0.44
81 0.55
82 0.62
83 0.71
84 0.79
85 0.82
86 0.88
87 0.89
88 0.88
89 0.88
90 0.88