Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1BUY2

Protein Details
Accession A0A2I1BUY2   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-24FQLFERARKRCKKLVNVQAWDHydrophilic
118-141MALKAPASKVEKKTRKRQKQTVHEHydrophilic
NLS Segment(s)
PositionSequence
126-134KVEKKTRKR
Subcellular Location(s) nucl 17.5, mito_nucl 12.5, mito 6.5
Family & Domain DBs
Amino Acid Sequences MEAFQLFERARKRCKKLVNVQAWDEALLLQLCQPDQVLFGPTEVDGNLDEDLIKWILQPEPQELTSKRRRKNTSKTKVDSGKTSVPALRPKFATGEVTELVAKHSTSISSPLKSNDGMALKAPASKVEKKTRKRQKQTVHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.75
3 0.79
4 0.83
5 0.83
6 0.79
7 0.75
8 0.7
9 0.6
10 0.5
11 0.39
12 0.28
13 0.19
14 0.14
15 0.1
16 0.08
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.08
23 0.09
24 0.09
25 0.08
26 0.09
27 0.09
28 0.08
29 0.09
30 0.08
31 0.07
32 0.06
33 0.07
34 0.07
35 0.06
36 0.06
37 0.06
38 0.08
39 0.07
40 0.07
41 0.06
42 0.07
43 0.08
44 0.1
45 0.11
46 0.11
47 0.14
48 0.14
49 0.18
50 0.18
51 0.25
52 0.34
53 0.41
54 0.44
55 0.5
56 0.58
57 0.63
58 0.73
59 0.77
60 0.77
61 0.79
62 0.78
63 0.77
64 0.76
65 0.69
66 0.61
67 0.54
68 0.48
69 0.39
70 0.37
71 0.31
72 0.28
73 0.34
74 0.33
75 0.31
76 0.27
77 0.27
78 0.27
79 0.26
80 0.25
81 0.18
82 0.19
83 0.16
84 0.17
85 0.16
86 0.14
87 0.15
88 0.13
89 0.12
90 0.09
91 0.09
92 0.08
93 0.09
94 0.16
95 0.18
96 0.19
97 0.22
98 0.23
99 0.26
100 0.25
101 0.25
102 0.24
103 0.22
104 0.21
105 0.2
106 0.2
107 0.18
108 0.2
109 0.19
110 0.19
111 0.23
112 0.3
113 0.37
114 0.46
115 0.56
116 0.63
117 0.74
118 0.8
119 0.85
120 0.89
121 0.91