Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1CHN8

Protein Details
Accession A0A2I1CHN8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-31LLRIGVKEAKKHKAKKNAANTSTTHydrophilic
NLS Segment(s)
PositionSequence
14-23KEAKKHKAKK
Subcellular Location(s) plas 16, mito 5, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008253  Marvel  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01284  MARVEL  
Amino Acid Sequences MWFLILKLLRIGVKEAKKHKAKKNAANTSTTDSESINLNRDTNMPCPADSTTARNPLITLLETILRFIQFVFGLTVIGLYGRDLHGEDKAAAPAKWVYAVVTAFLAVMTAAVYLVLPFVMEGRTPVARRARVQLPLFVWESVLCVLWLTLFGIFGKMYIGNYSEGDKVKRMRHAVWVDLVNLGLWVVTMGWVGLRWWRGEGDRREGEGDGGCREG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.54
4 0.62
5 0.7
6 0.75
7 0.78
8 0.81
9 0.83
10 0.86
11 0.87
12 0.81
13 0.76
14 0.7
15 0.66
16 0.58
17 0.49
18 0.39
19 0.28
20 0.25
21 0.25
22 0.24
23 0.22
24 0.21
25 0.2
26 0.2
27 0.23
28 0.25
29 0.23
30 0.27
31 0.23
32 0.22
33 0.23
34 0.24
35 0.25
36 0.23
37 0.27
38 0.27
39 0.33
40 0.33
41 0.31
42 0.3
43 0.27
44 0.27
45 0.22
46 0.17
47 0.1
48 0.13
49 0.13
50 0.13
51 0.13
52 0.11
53 0.1
54 0.09
55 0.1
56 0.07
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.05
64 0.05
65 0.04
66 0.03
67 0.04
68 0.04
69 0.05
70 0.05
71 0.06
72 0.07
73 0.08
74 0.08
75 0.08
76 0.1
77 0.11
78 0.1
79 0.11
80 0.1
81 0.1
82 0.1
83 0.09
84 0.07
85 0.08
86 0.08
87 0.07
88 0.06
89 0.06
90 0.05
91 0.05
92 0.05
93 0.03
94 0.03
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.03
106 0.03
107 0.03
108 0.04
109 0.06
110 0.08
111 0.09
112 0.14
113 0.19
114 0.22
115 0.24
116 0.29
117 0.31
118 0.36
119 0.37
120 0.36
121 0.31
122 0.32
123 0.32
124 0.26
125 0.22
126 0.15
127 0.15
128 0.11
129 0.1
130 0.07
131 0.05
132 0.05
133 0.05
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.06
140 0.05
141 0.06
142 0.06
143 0.06
144 0.07
145 0.07
146 0.09
147 0.09
148 0.1
149 0.12
150 0.15
151 0.17
152 0.18
153 0.22
154 0.26
155 0.3
156 0.36
157 0.38
158 0.36
159 0.44
160 0.46
161 0.45
162 0.44
163 0.41
164 0.35
165 0.31
166 0.29
167 0.19
168 0.15
169 0.12
170 0.06
171 0.04
172 0.04
173 0.03
174 0.03
175 0.03
176 0.03
177 0.04
178 0.04
179 0.05
180 0.09
181 0.11
182 0.12
183 0.13
184 0.16
185 0.21
186 0.31
187 0.36
188 0.41
189 0.44
190 0.46
191 0.47
192 0.45
193 0.42
194 0.37
195 0.33