Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1C8Y9

Protein Details
Accession A0A2I1C8Y9   
Localization Confidence High
Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
119-149RPPRPERSQDHNPRERRNRRKPKPSAFAKEMBasic
NLS Segment(s)
PositionSequence
23-26KKRK
41-60RRKAQKIKSDLIQKAKVKKA
121-193PRPERSQDHNPRERRNRRKPKPSAFAKEMEIAEKRRKEAERRREEREFKMKDREAMARAKKPAPDGKRRLGRE
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MAKRSRDADANPEEKRTTEPPVKKRKGFSVGPANLPDGTYRRKAQKIKSDLIQKAKVKKAYAKIKAEELASTPKRPIYATEEHAEGENANGDNVVDPAPASLELHPDRQAMLNEPVPERPPRPERSQDHNPRERRNRRKPKPSAFAKEMEIAEKRRKEAERRREEREFKMKDREAMARAKKPAPDGKRRLGRESKVLLNRIQHIVGQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.38
4 0.37
5 0.4
6 0.47
7 0.53
8 0.64
9 0.72
10 0.73
11 0.75
12 0.76
13 0.74
14 0.68
15 0.67
16 0.67
17 0.62
18 0.6
19 0.56
20 0.49
21 0.41
22 0.38
23 0.31
24 0.24
25 0.24
26 0.25
27 0.29
28 0.34
29 0.42
30 0.49
31 0.56
32 0.62
33 0.65
34 0.65
35 0.68
36 0.69
37 0.68
38 0.68
39 0.68
40 0.63
41 0.63
42 0.64
43 0.61
44 0.55
45 0.56
46 0.58
47 0.59
48 0.63
49 0.61
50 0.56
51 0.56
52 0.54
53 0.48
54 0.39
55 0.31
56 0.32
57 0.28
58 0.27
59 0.24
60 0.23
61 0.23
62 0.22
63 0.23
64 0.2
65 0.23
66 0.26
67 0.26
68 0.26
69 0.25
70 0.25
71 0.23
72 0.16
73 0.1
74 0.09
75 0.07
76 0.06
77 0.06
78 0.05
79 0.05
80 0.06
81 0.06
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.05
89 0.09
90 0.1
91 0.12
92 0.13
93 0.13
94 0.13
95 0.14
96 0.14
97 0.13
98 0.15
99 0.16
100 0.16
101 0.17
102 0.18
103 0.18
104 0.2
105 0.18
106 0.22
107 0.26
108 0.3
109 0.35
110 0.44
111 0.47
112 0.54
113 0.63
114 0.67
115 0.71
116 0.74
117 0.74
118 0.75
119 0.8
120 0.82
121 0.82
122 0.83
123 0.85
124 0.87
125 0.92
126 0.92
127 0.92
128 0.91
129 0.9
130 0.87
131 0.8
132 0.73
133 0.64
134 0.59
135 0.49
136 0.42
137 0.36
138 0.31
139 0.35
140 0.35
141 0.34
142 0.36
143 0.41
144 0.48
145 0.55
146 0.62
147 0.65
148 0.68
149 0.74
150 0.77
151 0.78
152 0.77
153 0.77
154 0.73
155 0.67
156 0.72
157 0.67
158 0.61
159 0.6
160 0.56
161 0.5
162 0.52
163 0.54
164 0.51
165 0.53
166 0.53
167 0.51
168 0.53
169 0.58
170 0.57
171 0.6
172 0.62
173 0.67
174 0.72
175 0.74
176 0.76
177 0.76
178 0.72
179 0.7
180 0.68
181 0.67
182 0.65
183 0.65
184 0.6
185 0.56
186 0.56
187 0.51
188 0.46