Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8MMT0

Protein Details
Accession B8MMT0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
102-121AAKTRKYNWSEKAKRRKTTGHydrophilic
NLS Segment(s)
PositionSequence
113-118KAKRRK
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences MSTSRTLLRSTLTTIRRVPPALVSVTTRRTRSADDAIFEGNCGVNFKSGSEGISMEMNTKGRREWPGYPRRRDGEGLFTNCQGRKRSFHIQKSTCANCGYPAAKTRKYNWSEKAKRRKTTGTGRMRYLKTVDRKFHNGFQTGTPKGARGPTTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.43
4 0.42
5 0.38
6 0.33
7 0.33
8 0.3
9 0.28
10 0.27
11 0.28
12 0.34
13 0.37
14 0.35
15 0.34
16 0.34
17 0.36
18 0.38
19 0.41
20 0.36
21 0.33
22 0.33
23 0.32
24 0.29
25 0.25
26 0.2
27 0.12
28 0.1
29 0.1
30 0.09
31 0.09
32 0.09
33 0.09
34 0.11
35 0.11
36 0.11
37 0.11
38 0.11
39 0.1
40 0.11
41 0.1
42 0.09
43 0.11
44 0.12
45 0.12
46 0.12
47 0.12
48 0.14
49 0.18
50 0.21
51 0.27
52 0.35
53 0.45
54 0.53
55 0.58
56 0.61
57 0.59
58 0.58
59 0.53
60 0.44
61 0.43
62 0.39
63 0.38
64 0.33
65 0.31
66 0.31
67 0.31
68 0.33
69 0.27
70 0.24
71 0.24
72 0.29
73 0.39
74 0.45
75 0.52
76 0.58
77 0.58
78 0.61
79 0.65
80 0.6
81 0.52
82 0.44
83 0.36
84 0.27
85 0.29
86 0.24
87 0.19
88 0.24
89 0.28
90 0.33
91 0.36
92 0.4
93 0.45
94 0.49
95 0.55
96 0.56
97 0.61
98 0.65
99 0.72
100 0.79
101 0.79
102 0.8
103 0.79
104 0.78
105 0.75
106 0.76
107 0.76
108 0.76
109 0.72
110 0.72
111 0.74
112 0.68
113 0.63
114 0.56
115 0.54
116 0.53
117 0.57
118 0.57
119 0.56
120 0.62
121 0.64
122 0.67
123 0.65
124 0.59
125 0.52
126 0.52
127 0.53
128 0.47
129 0.46
130 0.39
131 0.34
132 0.34
133 0.37