Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1CMF6

Protein Details
Accession A0A2I1CMF6   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
35-70REKRTNASGERQKKKKKRQKEKKKKREHLKIQASTVBasic
NLS Segment(s)
PositionSequence
33-62KTREKRTNASGERQKKKKKRQKEKKKKREH
Subcellular Location(s) nucl 18.5, cyto_nucl 13.333, mito_nucl 11.166, cyto 6
Family & Domain DBs
Amino Acid Sequences MFIIEITASSRTEQEGQGYGNDVTLLVGELCKKTREKRTNASGERQKKKKKRQKEKKKKREHLKIQASTVGPLPTATSHCRFLRSVTTNVVNPGMTVNFTTISWREHSSAASLIQLLEVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.19
4 0.18
5 0.2
6 0.18
7 0.15
8 0.14
9 0.11
10 0.09
11 0.08
12 0.07
13 0.05
14 0.05
15 0.07
16 0.09
17 0.1
18 0.13
19 0.17
20 0.24
21 0.35
22 0.44
23 0.5
24 0.57
25 0.65
26 0.72
27 0.73
28 0.75
29 0.74
30 0.75
31 0.77
32 0.77
33 0.78
34 0.77
35 0.84
36 0.85
37 0.86
38 0.88
39 0.9
40 0.93
41 0.94
42 0.96
43 0.95
44 0.97
45 0.96
46 0.95
47 0.95
48 0.93
49 0.92
50 0.91
51 0.84
52 0.74
53 0.68
54 0.57
55 0.47
56 0.38
57 0.27
58 0.17
59 0.13
60 0.12
61 0.08
62 0.11
63 0.14
64 0.15
65 0.2
66 0.21
67 0.23
68 0.23
69 0.25
70 0.31
71 0.32
72 0.32
73 0.32
74 0.34
75 0.32
76 0.34
77 0.33
78 0.23
79 0.19
80 0.17
81 0.13
82 0.11
83 0.1
84 0.1
85 0.09
86 0.09
87 0.13
88 0.13
89 0.15
90 0.17
91 0.2
92 0.2
93 0.21
94 0.22
95 0.21
96 0.22
97 0.2
98 0.18
99 0.16
100 0.14