Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1CMX7

Protein Details
Accession A0A2I1CMX7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-65ITVTIIRRGKKKKERKKKPSHLMGLVCHydrophilic
NLS Segment(s)
PositionSequence
30-35RRPPPS
43-57IIRRGKKKKERKKKP
Subcellular Location(s) mito 14.5, mito_nucl 13.333, nucl 11, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MRRIYGVRSNRYSTPCPPAQCCRVGLHRPRRPPPSIKNITVTIIRRGKKKKERKKKPSHLMGLVCGLNTFMYLTSCRDLCTTTAKAGDPVTSSHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.51
3 0.5
4 0.51
5 0.53
6 0.52
7 0.5
8 0.48
9 0.44
10 0.46
11 0.5
12 0.55
13 0.58
14 0.61
15 0.67
16 0.72
17 0.74
18 0.72
19 0.72
20 0.7
21 0.7
22 0.69
23 0.62
24 0.58
25 0.53
26 0.49
27 0.45
28 0.38
29 0.35
30 0.35
31 0.35
32 0.38
33 0.43
34 0.51
35 0.57
36 0.66
37 0.69
38 0.74
39 0.83
40 0.87
41 0.93
42 0.94
43 0.94
44 0.93
45 0.89
46 0.85
47 0.75
48 0.65
49 0.57
50 0.46
51 0.36
52 0.25
53 0.18
54 0.11
55 0.09
56 0.08
57 0.05
58 0.06
59 0.07
60 0.1
61 0.12
62 0.13
63 0.14
64 0.14
65 0.15
66 0.16
67 0.21
68 0.21
69 0.22
70 0.25
71 0.24
72 0.26
73 0.26
74 0.26
75 0.2