Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1CNL3

Protein Details
Accession A0A2I1CNL3    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
12-39LLWKIPWRISQPQKARQRKRLRAVDRVVHydrophilic
78-99FDKKEKTYRKGIHKLPKWTRVSBasic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKASSPLFSGLLWKIPWRISQPQKARQRKRLRAVDRVVDTLSAALRRNGQSTKAVDRWYAEMPREEEMLPKDKYTLFDKKEKTYRKGIHKLPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.22
4 0.27
5 0.28
6 0.37
7 0.42
8 0.51
9 0.58
10 0.65
11 0.73
12 0.8
13 0.84
14 0.85
15 0.87
16 0.87
17 0.88
18 0.89
19 0.85
20 0.83
21 0.79
22 0.76
23 0.67
24 0.59
25 0.49
26 0.38
27 0.31
28 0.22
29 0.18
30 0.12
31 0.1
32 0.09
33 0.12
34 0.13
35 0.15
36 0.16
37 0.17
38 0.19
39 0.21
40 0.25
41 0.25
42 0.25
43 0.23
44 0.23
45 0.24
46 0.23
47 0.22
48 0.19
49 0.19
50 0.19
51 0.2
52 0.2
53 0.18
54 0.17
55 0.18
56 0.23
57 0.2
58 0.19
59 0.19
60 0.19
61 0.22
62 0.26
63 0.32
64 0.3
65 0.38
66 0.42
67 0.49
68 0.57
69 0.62
70 0.61
71 0.63
72 0.67
73 0.69
74 0.74
75 0.76
76 0.77
77 0.77
78 0.83
79 0.82
80 0.84
81 0.79
82 0.78
83 0.79
84 0.79
85 0.8
86 0.77
87 0.79